Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 167 / 1e-46 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 144 / 3e-41 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72930 137 / 5e-40 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72940 140 / 4e-39 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72860 145 / 6e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72910 140 / 9e-39 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 137 / 6e-38 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G17680 140 / 3e-37 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G72890 135 / 2e-36 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G17615 132 / 5e-36 Disease resistance protein (TIR-NBS class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G004233 [exp] 248 / 4e-82 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.005G004500 [exp] 242 / 4e-80 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269950 [exp] 241 / 6e-80 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G003900 [exp] 233 / 2e-76 AT5G36930 146 / 8e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008740 [exp] 242 / 1e-74 AT5G36930 420 / 7e-132 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G099700 [exp] 245 / 6e-74 AT5G36930 562 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283800 [exp] 233 / 2e-73 AT5G36930 286 / 1e-85 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008228 [exp] 240 / 4e-73 AT5G36930 468 / 3e-148 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G012000 [exp] 241 / 2e-72 AT5G36930 489 / 2e-153 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011741 [exp] 209 / 6e-61 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 206 / 7e-60 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10018972 [exp] 182 / 1e-52 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 165 / 7e-46 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 165 / 9e-46 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 160 / 3e-44 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 152 / 3e-44 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10041060 [exp] 157 / 5e-43 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015453 [exp] 152 / 1e-42 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10019708 [exp] 153 / 2e-41 AT5G17680 495 / 1e-150 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.004G230000.1 pacid=42793931 polypeptide=Potri.004G230000.1.p locus=Potri.004G230000 ID=Potri.004G230000.1.v4.1 annot-version=v4.1 ATGGCTTTTACGTCGTATACTTACCAGGTGTTCTTGAGTTTTAGAGGCGAAGACACCCGCAAGAATTTCACCGATCACCTTTACTCGACGTTGTCCAAGG CAGGGATTGTCACGTTCAGAGACGATAATAGCATCCAGAGAGGAGAAAACATCGAGTTAGAAATAGAGAAGGCAATCCAAGAATCGCAAATGTCAGTTGT TGTGCTCTCTAAAGATTATGCTTCTTCGACATGGTGCCTAGACGAACTTGTGATGATCATGGATCGTAAGAGGACTGCTGGACATATTGTTCTACCTGTT TTCTACGATGTGGATCCATCTCAAGTTGGGGAGCAGACAGGGAATTATGCTGAAGCCTTTGCTAAACACCAAGATCATTTCCAGGATGACATGGAGAGGG TAGAGAAATGGAAGGCAACACTCAAAGAAGTTGCATACCTGGGAGGGATGGTTCTACAGGATAGGCACGAGTCACAATTCATTGGAGACATAGTTGAAGA GGTAGGAAAGAGACTGGACTCCACTGTACTGCTTGCTCCTTATATTGCCTGGCATAGATACCGGCTGCTCGTGAAGAAGACGAAGATGATTGTATACATA CTCTATATCATATGTATTTCGATTTTTGTTGGTTTGTTTCTCTACAAATTTATCTGCACTTGGATATTCCTACAATCAGAGTTTGACCGCCATCTCAAAG GCGACCAATATGATCGAGTAATTTGGAAAATAGGAAATGGACCCAATAGAGCTGGGACCGAGCAAGATTTTGTTAGGGAATTACTCCGCAGCACTGGGAC CAAGAAAAATATTGATATGGGAATCAAAATCATGTGTTCGTTGGTGCTAGCATTCTGTCTATCATAA
AA sequence Show only first row Show all	>Potri.004G230000.1 pacid=42793931 polypeptide=Potri.004G230000.1.p locus=Potri.004G230000 ID=Potri.004G230000.1.v4.1 annot-version=v4.1 MAFTSYTYQVFLSFRGEDTRKNFTDHLYSTLSKAGIVTFRDDNSIQRGENIELEIEKAIQESQMSVVVLSKDYASSTWCLDELVMIMDRKRTAGHIVLPV FYDVDPSQVGEQTGNYAEAFAKHQDHFQDDMERVEKWKATLKEVAYLGGMVLQDRHESQFIGDIVEEVGKRLDSTVLLAPYIAWHRYRLLVKKTKMIVYI LYIICISIFVGLFLYKFICTWIFLQSEFDRHLKGDQYDRVIWKIGNGPNRAGTEQDFVRELLRSTGTKKNIDMGIKIMCSLVLAFCLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.004G230000 [exp]	0	1
AT5G10695			unknown protein		Potri.010G251000 [exp]	1.41	0.9114
AT5G42050			DCD (Development and Cell Deat...		Potri.003G141900 [exp]	1.41	0.8794
AT1G71400		AtRLP12	receptor like protein 12 (.1)		Potri.012G025700 [exp]	4.00	0.8772
AT5G14420		RGLG2	RING domain ligase2 (.1.2.3.4)		Potri.010G049600 [exp]	4.58	0.8561
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Potri.001G332900 [exp]	10.67	0.8789
AT5G47650		ATNUDX2, ATNUDT...	ARABIDOPSIS THALIANA NUDIX HYD...		Potri.014G168400 [exp]	13.41	0.8315
AT4G13810		AtRLP47	receptor like protein 47 (.1.2...		Potri.012G019850 [exp]	18.11	0.7362
AT4G12731			unknown protein		Potri.001G226650 [exp]	19.20	0.8550
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Potri.019G007227 [exp]	19.74	0.8570
AT4G12731			unknown protein		Potri.001G226750 [exp]	21.44	0.8518

Compare expression of checked genes

Potri.004G230000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.