Potri.004G231576 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G231700 39 / 2e-05 AT5G49760 1031 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.004G232400 36 / 0.0002 AT5G49760 1013 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G231576.1 pacid=42794280 polypeptide=Potri.004G231576.1.p locus=Potri.004G231576 ID=Potri.004G231576.1.v4.1 annot-version=v4.1
ATGCAAGCATTCTTTCCACGACAAACAACTATGACGATGCAAGCAAGGGATGCCTTTGATTACAGAGGGGACTTCCCAGTTTCAAAGGTAGAGCCACTAT
ATATGATCGAGTGA
AA sequence
>Potri.004G231576.1 pacid=42794280 polypeptide=Potri.004G231576.1.p locus=Potri.004G231576 ID=Potri.004G231576.1.v4.1 annot-version=v4.1
MQAFFPRQTTMTMQARDAFDYRGDFPVSKVEPLYMIE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G231576 0 1
Potri.007G085550 1.00 0.9952
AT1G22370 ATUGT85A5 UDP-glucosyl transferase 85A5 ... Potri.004G172700 1.41 0.9722
AT1G54570 Esterase/lipase/thioesterase f... Potri.013G033000 8.36 0.9141
AT1G03400 2-oxoglutarate (2OG) and Fe(II... Potri.010G107500 8.71 0.9142
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056200 9.16 0.9130
AT5G13800 CRN1, PPH Co-regulated with NYE1, pheoph... Potri.009G054800 13.74 0.9106
AT3G24170 ATGR1 glutathione-disulfide reductas... Potri.003G178200 14.24 0.8634 GR.1
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056366 15.42 0.8837
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056316 16.43 0.8795
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056258 19.49 0.8732

Potri.004G231576 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.