Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05390 94 / 1e-23 unknown protein AT4G01240 91 / 3e-22 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT1G29790 89 / 6e-22 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) AT5G40830 85 / 1e-20 ATRAD3, ATATR S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) AT3G27230 82 / 1e-19 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G231100 [exp] 224 / 5e-73 AT3G05390 287 / 2e-92 unknown protein Potri.017G135100 [exp] 149 / 8e-45 AT3G05390 278 / 3e-89 unknown protein Potri.004G083800 [exp] 147 / 2e-43 AT3G05390 278 / 3e-89 unknown protein Potri.001G352700 [exp] 101 / 1e-26 AT1G29790 437 / 2e-153 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Potri.002G165300 [exp] 97 / 8e-25 AT4G01240 662 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.011G079000 [exp] 94 / 7e-24 AT1G29790 439 / 2e-154 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Potri.004G116900 [exp] 94 / 1e-23 AT4G01240 388 / 7e-129 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.013G019400 [exp] 91 / 2e-22 AT3G05390 753 / 0.0 unknown protein Potri.005G236600 [exp] 89 / 5e-22 AT3G27230 634 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012158 [exp] 195 / 6e-66 AT5G40830 120 / 8e-33 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10007588 [exp] 198 / 3e-63 AT5G40830 232 / 6e-72 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10007385 [exp] 150 / 5e-45 AT5G40830 277 / 1e-89 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10020803 [exp] 150 / 7e-45 AT5G40830 282 / 1e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10015264 [exp] 99 / 1e-25 AT1G29790 504 / 1e-179 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10010138 [exp] 98 / 4e-25 AT4G01240 620 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10025384 [exp] 95 / 5e-24 AT1G29790 501 / 3e-178 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10031968 [exp] 93 / 3e-23 AT4G01240 372 / 2e-122 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10035135 [exp] 92 / 8e-23 AT4G01240 367 / 1e-120 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10029907 [exp] 88 / 1e-21 AT3G05390 697 / 0.0 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF08241 [poplar] [flax] Methyltransf_11 Methyltransferase domain
Representative CDS sequence Show only first row Show all	>Potri.004G232200.1 pacid=42794657 polypeptide=Potri.004G232200.1.p locus=Potri.004G232200 ID=Potri.004G232200.1.v4.1 annot-version=v4.1 ATGGTCCAAAGCTTAGTGATCTCATTCGACGTCAGTGTTTCTCAGAGGCTTCCATTCTTTGACAACACTCTAGACATAGTTCATTCGATGCATGTTCTGA GCAACTGGATTCCAGATGCGATGTTGGAATTCACACTCTATGATATATACAGAGTGTTGAGGCCAGGGGGACTCTTCTGGCTTGATCGCTTCTTCTGCCT GGGATCACAGCTGAATCAAACATACGTTCCAATGTTGGATCGTGTTGGATTCAGGAACCTAAGGTGGAACGCTGGCATGAAGCTTGAACGAGGGATTGAC AAAAACGAGTGGTATTTCTCTGCCCTGTTGGAGAAACCAATGACCTGA
AA sequence Show only first row Show all	>Potri.004G232200.1 pacid=42794657 polypeptide=Potri.004G232200.1.p locus=Potri.004G232200 ID=Potri.004G232200.1.v4.1 annot-version=v4.1 MVQSLVISFDVSVSQRLPFFDNTLDIVHSMHVLSNWIPDAMLEFTLYDIYRVLRPGGLFWLDRFFCLGSQLNQTYVPMLDRVGFRNLRWNAGMKLERGID KNEWYFSALLEKPMT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05390			unknown protein		Potri.004G232200 [exp]	0	1
					Potri.007G022950 [exp]	4.24	0.7513
AT1G16670			Protein kinase superfamily pro...		Potri.010G221400 [exp]	4.47	0.7547
AT3G50760		GATL2	galacturonosyltransferase-like...		Potri.005G128000 [exp]	6.92	0.7585
AT2G17070			Arabidopsis protein of unknown...		Potri.009G142500 [exp]	10.24	0.7476
AT4G31980			unknown protein		Potri.003G209100 [exp]	33.36	0.6915
AT3G05950			RmlC-like cupins superfamily p...		Potri.011G162932 [exp]	48.92	0.7291
AT5G64310		ATAGP1, AGP1	arabinogalactan protein 1 (.1)		Potri.001G310400 [exp]	64.87	0.6838
AT3G23750			Leucine-rich repeat protein ki...		Potri.006G073900 [exp]	79.14	0.6720	RHG4.2
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Potri.006G249500 [exp]	79.54	0.7044
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Potri.009G027200 [exp]	81.33	0.6730

Compare expression of checked genes

Potri.004G232200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.