Plant FIBer expression Database

Potri.005G000700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26731 64 / 3e-14 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G000401
[exp]
151 / 3e-48 AT5G26731 47 / 6e-08 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G000700.1 pacid=42803612 polypeptide=Potri.005G000700.1.p locus=Potri.005G000700 ID=Potri.005G000700.1.v4.1 annot-version=v4.1
ATGGCTCTGGTAATGAACCGCAACTACAGCTACAACACTAGCCATCATCTGGGGCCAACTCCGCTGTCGAGGAGCAGCAGTAGCGGTACTTGGAATGAGT
TATTAGGAGGATATAGCAATAGTTCAGAGCATTACAGCAGCAGCAGCTCAGTGGTGATGATGGAGAAGAGACAGTTATTTCTTAGAAGCTACCAGTTCTG
CAGGAAAAGAACCCTAACAGAAAGGATCAAGGGTTCTTTGATAAGAGCGAAGAAAGTGATGTGGCTGAGACTAAGATCTGCTCGTAAAATTAGAAGGTTG
GTTTGGTCCAGACTCCGTTATGCATTCTACTGTCGCCGCAGAAGAAGATTTCTTCGCCTCATCAACCATAATCATCACAACTCATCCACCTGCACTTTCT
GGTAG
AA sequence
>Potri.005G000700.1 pacid=42803612 polypeptide=Potri.005G000700.1.p locus=Potri.005G000700 ID=Potri.005G000700.1.v4.1 annot-version=v4.1
MALVMNRNYSYNTSHHLGPTPLSRSSSSGTWNELLGGYSNSSEHYSSSSSVVMMEKRQLFLRSYQFCRKRTLTERIKGSLIRAKKVMWLRLRSARKIRRL
VWSRLRYAFYCRRRRRFLRLINHNHHNSSTCTFW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G26731 unknown protein Potri.005G000700
[exp]
0 1
AT4G02860 Phenazine biosynthesis PhzC/Ph... Potri.010G175700
[exp]
1.41 0.9384
AT4G37420 Domain of unknown function (DU... Potri.005G252100
[exp]
2.00 0.9364
AT5G25260 SPFH/Band 7/PHB domain-contain... Potri.018G022900
[exp]
11.66 0.9027
AT1G04520 PDLP2 plasmodesmata-located protein ... Potri.013G048200
[exp]
14.89 0.9298
AT1G29000 Heavy metal transport/detoxifi... Potri.014G178800
[exp]
15.49 0.9260
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Potri.006G154500
[exp]
16.37 0.8742
AT3G18400 NAC ANAC058 NAC domain containing protein ... Potri.012G056300
[exp]
18.57 0.9269
AT1G22370 ATUGT85A5 UDP-glucosyl transferase 85A5 ... Potri.016G021600
[exp]
18.65 0.9283
AT2G22590 UDP-Glycosyltransferase superf... Potri.012G034100
[exp]
21.35 0.8902
AT4G02860 Phenazine biosynthesis PhzC/Ph... Potri.010G175701
[exp]
22.60 0.8921

Potri.005G000700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.