Plant FIBer expression Database

Potri.005G000800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05936 57 / 3e-11 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G000100
[exp]
187 / 3e-62 AT3G05936 60 / 2e-12 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G000800.1 pacid=42803118 polypeptide=Potri.005G000800.1.p locus=Potri.005G000800 ID=Potri.005G000800.1.v4.1 annot-version=v4.1
ATGGGTTTCCAAGCTAATGCTGTAATCCCCTCGAGGTTCCGCTACGAGAAGCTTATTAATGGCGGTGATCAATATCATGAAAAATTAATGGCAAGGCCTA
GACGATGGCGTTTTTGGGTGAAGAAAATGAATGGAGGGGTAAAGGGTCTTCGATTATCCCGCTCCAGGAAACTCACTTTCAAGGCATTGTCTGTGATCCT
AATGCCGAGCCCAAACAGCAGGATTGCAAAAGTGTATGCCCATGTTATTGATAGAATCAAGATGATGGATGATCTGACTCTGTATCCCAACATTATCTTC
TCCACTCATTGGGGGCTTCCAGTTTTATCCCATCCATCTGTTAAAACCACTACAAGGCTGAGTTCTCTTCATACAAACTTAACCTGCATTTAG
AA sequence
>Potri.005G000800.1 pacid=42803118 polypeptide=Potri.005G000800.1.p locus=Potri.005G000800 ID=Potri.005G000800.1.v4.1 annot-version=v4.1
MGFQANAVIPSRFRYEKLINGGDQYHEKLMARPRRWRFWVKKMNGGVKGLRLSRSRKLTFKALSVILMPSPNSRIAKVYAHVIDRIKMMDDLTLYPNIIF
STHWGLPVLSHPSVKTTTRLSSLHTNLTCI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05936 unknown protein Potri.005G000800
[exp]
0 1
AT1G11580 ATPMEPCRA methylesterase PCR A (.1) Potri.011G135000
[exp]
2.00 0.8333
AT5G28150 Plant protein of unknown funct... Potri.005G050900
[exp]
3.60 0.8450
AT3G16300 Uncharacterised protein family... Potri.003G050400
[exp]
5.74 0.8140
AT4G39900 unknown protein Potri.007G093200
[exp]
6.32 0.8123
AT5G56230 PRA1.G2 prenylated RAB acceptor 1.G2 (... Potri.001G472300
[exp]
8.36 0.7689
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Potri.009G068000
[exp]
11.61 0.7623
AT1G73620 Pathogenesis-related thaumatin... Potri.012G047800
[exp]
12.24 0.8082
AT4G08330 unknown protein Potri.005G178000
[exp]
12.40 0.7550
Potri.016G052400
[exp]
14.49 0.8068
AT1G07710 Ankyrin repeat family protein ... Potri.007G099600
[exp]
17.66 0.6568

Potri.005G000800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.