Pt-GER1.1 (Potri.005G001300) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-GER1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62020 309 / 6e-108 GLP10 germin-like protein 10 (.1.2)
AT1G09560 303 / 1e-105 GLP5 germin-like protein 5 (.1)
AT1G02335 300 / 2e-104 GL22 germin-like protein subfamily 2 member 2 precursor (.1)
AT5G26700 261 / 5e-89 RmlC-like cupins superfamily protein (.1)
AT3G05930 248 / 8e-84 GLP8 germin-like protein 8 (.1)
AT1G18970 221 / 3e-73 GLP4 germin-like protein 4 (.1)
AT1G18980 219 / 3e-72 RmlC-like cupins superfamily protein (.1)
AT4G14630 198 / 5e-64 GLP9 germin-like protein 9 (.1)
AT3G05950 192 / 1e-61 RmlC-like cupins superfamily protein (.1)
AT5G39110 191 / 2e-61 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G000500 380 / 5e-136 AT1G09560 311 / 1e-108 germin-like protein 5 (.1)
Potri.014G110400 322 / 8e-113 AT3G62020 328 / 2e-115 germin-like protein 10 (.1.2)
Potri.002G184900 320 / 2e-112 AT3G62020 332 / 3e-117 germin-like protein 10 (.1.2)
Potri.015G068200 241 / 5e-81 AT1G18980 247 / 2e-83 RmlC-like cupins superfamily protein (.1)
Potri.011G163800 211 / 2e-69 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1)
Potri.011G163200 210 / 8e-69 AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1)
Potri.011G162932 208 / 3e-68 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1)
Potri.001G465100 206 / 3e-67 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3)
Potri.011G163216 202 / 8e-66 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038014 319 / 7e-112 AT3G62020 327 / 5e-115 germin-like protein 10 (.1.2)
Lus10009254 294 / 1e-101 AT3G62020 306 / 1e-106 germin-like protein 10 (.1.2)
Lus10032016 213 / 4e-70 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10036658 211 / 5e-69 AT1G18980 229 / 3e-76 RmlC-like cupins superfamily protein (.1)
Lus10032015 210 / 9e-69 AT5G39160 262 / 3e-89 RmlC-like cupins superfamily protein (.1.2.3)
Lus10035278 209 / 1e-68 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1)
Lus10015128 209 / 2e-68 AT3G05950 238 / 7e-80 RmlC-like cupins superfamily protein (.1)
Lus10035185 209 / 3e-68 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10030048 207 / 8e-68 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1)
Lus10035186 207 / 1e-67 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF07883 Cupin_2 Cupin domain
Representative CDS sequence
>Potri.005G001300.1 pacid=42803027 polypeptide=Potri.005G001300.1.p locus=Potri.005G001300 ID=Potri.005G001300.1.v4.1 annot-version=v4.1
ATGGCAGCTAATAAGGTGGCCTACCTCTCCCTTCTTTATATGACTCTTGGTTTGGTACTAGTGGCCACCGTTTCTGCTGATCCTGACCTGCTTCAAGATG
TTTGCGTTGCTGATCTTTCTTCTGGTGTGAAGGTGAATGGATTCACCTGCAAGGAAAACATATCGGCAGAGGACTTCTTCTTTGCCGGTTTGGCTAAACC
AGGTCTCACCAACAATACATTCGGCTCCTTGGTCACTGCTGCCAATGTTCAAAAGATCCCAGGACTCAACACCTTGGGGGTATCCATGTCCCGCATTGAC
TACGCCCCTGGTGGCTTAAATCCACCCCACACACATCCACGTGCCACTGAGATGGTCTTTGTCCTTGAAGGCCAACTGGACGTGGGGTTCATTACCACTG
CCAACGTTTTGATATCAAAGACCATCAAGGTGGGCGAGACATTTGTTTTCCCCAAAGGCTTGGTTCATTTCCAGAAGAACAACGGTCAAGTCTCAGCTGC
AGTGATTGCTGCATTCAATAGCCAGTTGCCAGGAACTCAGTCAATTGCAGCCACATTGTTTGCAGCCCAACCACCCGTGCCTGACCATGTCTTGACCAAG
GCTTTCCAGGTTGGTACCAAGGAGGTCCGAAAGATCAAGTCCAGGTTTGCACCTAAGAACTAG
AA sequence
>Potri.005G001300.1 pacid=42803027 polypeptide=Potri.005G001300.1.p locus=Potri.005G001300 ID=Potri.005G001300.1.v4.1 annot-version=v4.1
MAANKVAYLSLLYMTLGLVLVATVSADPDLLQDVCVADLSSGVKVNGFTCKENISAEDFFFAGLAKPGLTNNTFGSLVTAANVQKIPGLNTLGVSMSRID
YAPGGLNPPHTHPRATEMVFVLEGQLDVGFITTANVLISKTIKVGETFVFPKGLVHFQKNNGQVSAAVIAAFNSQLPGTQSIAATLFAAQPPVPDHVLTK
AFQVGTKEVRKIKSRFAPKN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G62020 GLP10 germin-like protein 10 (.1.2) Potri.005G001300 0 1 Pt-GER1.1
AT4G34660 SH3 domain-containing protein ... Potri.004G161300 9.74 0.8429
AT2G28310 Protein of unknown function (D... Potri.009G011000 10.19 0.8728
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Potri.010G211000 10.77 0.8045
AT5G03530 ATRABALPHA, AtR... ARABIDOPSIS THALIANA RAB GTPAS... Potri.010G229600 11.48 0.8543 RAB1.1
AT1G16860 Ubiquitin-specific protease fa... Potri.008G006100 14.14 0.8445
AT5G56520 unknown protein Potri.001G003500 16.52 0.7729
AT5G47530 Auxin-responsive family protei... Potri.010G156200 18.33 0.7757
AT2G30910 ARPC1B, ARPC1, ... actin-related protein C1A (.1.... Potri.014G141700 19.28 0.8512 Pt-ARPC1.1
AT1G47830 SNARE-like superfamily protein... Potri.005G238701 31.55 0.8266
AT4G22330 ATCES1 Alkaline phytoceramidase (aPHC... Potri.001G317400 31.62 0.8322

Potri.005G001300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.