Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05890 66 / 1e-16 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT3G05880 66 / 1e-16 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT2G38905 61 / 2e-14 Low temperature and salt responsive protein family (.1) AT1G57550 57 / 3e-13 Low temperature and salt responsive protein family (.1) AT2G24040 48 / 2e-09 Low temperature and salt responsive protein family (.1) AT4G30650 45 / 3e-08 Low temperature and salt responsive protein family (.1) AT4G28088 45 / 3e-08 Low temperature and salt responsive protein family (.1) AT4G30660 44 / 9e-08 Low temperature and salt responsive protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002100 [exp] 69 / 7e-18 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 65 / 2e-16 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 63 / 2e-15 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.008G044300 [exp] 60 / 4e-14 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 50 / 7e-10 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 46 / 1e-08 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029450 [exp] 78 / 2e-21 ND 87 / 6e-25 Lus10029449 [exp] 73 / 3e-19 ND 89 / 1e-25 Lus10005948 [exp] 69 / 6e-17 ND 85 / 5e-23 Lus10019890 [exp] 64 / 1e-15 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10014028 [exp] 64 / 1e-15 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10040370 [exp] 61 / 2e-14 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 61 / 2e-14 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10036592 [exp] 47 / 6e-09 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10035809 [exp] 47 / 6e-09 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [poplar] [flax] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Potri.005G002250.1 pacid=42802452 polypeptide=Potri.005G002250.1.p locus=Potri.005G002250 ID=Potri.005G002250.1.v4.1 annot-version=v4.1 ATGGCAGACGAGGGAACAGCTACTTGCATAGACATCTTGTTGGCCATCATCTTGCCTCCGCTTGGTGTCTTCCTCAAGTTTGGCTGCGGGGTGGAGTTTT GGATCTGCTTGCTTCTCACCTTCTTTGGCTACCTCCCTGGAATTATTTATGCTATCTACGCCATCACCAAGTGA
AA sequence Show only first row Show all	>Potri.005G002250.1 pacid=42802452 polypeptide=Potri.005G002250.1.p locus=Potri.005G002250 ID=Potri.005G002250.1.v4.1 annot-version=v4.1 MADEGTATCIDILLAIILPPLGVFLKFGCGVEFWICLLLTFFGYLPGIIYAIYAITK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05890		RCI2B	RARE-COLD-INDUCIBLE 2B, Low te...		Potri.005G002250 [exp]	0	1
AT5G39110			RmlC-like cupins superfamily p...		Potri.009G140400 [exp]	6.92	0.8706
AT1G05720			selenoprotein family protein (...		Potri.019G112100 [exp]	10.48	0.8741
AT2G34560			P-loop containing nucleoside t...		Potri.004G065100 [exp]	12.32	0.8900
AT5G61540			N-terminal nucleophile aminohy...		Potri.014G191900 [exp]	15.09	0.8807
AT5G37600		ATGLN1;1, GLN1;...	ARABIDOPSIS THALIANA GLUTAMINE...		Potri.007G069600 [exp]	15.49	0.8488
AT5G47540			Mo25 family protein (.1)		Potri.002G222800 [exp]	16.00	0.8811
AT3G18670			Ankyrin repeat family protein ...		Potri.008G022900 [exp]	22.13	0.8808
					Potri.011G134500 [exp]	22.73	0.8461
AT5G39220			alpha/beta-Hydrolases superfam...		Potri.017G093500 [exp]	25.49	0.8602
AT5G04700			Ankyrin repeat family protein ...		Potri.008G023500 [exp]	25.69	0.8533

Compare expression of checked genes

Potri.005G002250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.