Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 144 / 5e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 136 / 6e-39 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G27170 141 / 5e-38 transmembrane receptors;ATP binding (.1.2) AT1G72940 134 / 2e-37 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT4G11170 138 / 6e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G17615 133 / 1e-36 Disease resistance protein (TIR-NBS class) (.1) AT1G72930 127 / 1e-36 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72910 131 / 4e-36 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72860 135 / 5e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G48770 132 / 8e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G004500 [exp] 298 / 4e-103 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004233 [exp] 282 / 3e-96 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.004G230000 [exp] 228 / 1e-74 AT5G36930 169 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269950 [exp] 220 / 3e-72 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G015400 [exp] 229 / 4e-69 AT5G36930 438 / 1e-134 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008740 [exp] 225 / 8e-69 AT5G36930 420 / 7e-132 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G099700 [exp] 228 / 2e-68 AT5G36930 562 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G014101 [exp] 224 / 2e-68 AT5G36930 435 / 1e-137 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283500 [exp] 214 / 9e-68 AT5G36930 235 / 8e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 196 / 3e-57 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10011741 [exp] 196 / 4e-57 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041060 [exp] 157 / 2e-43 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 149 / 2e-43 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10011104 [exp] 155 / 9e-43 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10018972 [exp] 153 / 2e-42 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 150 / 3e-41 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 149 / 8e-41 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041606 [exp] 140 / 6e-40 AT5G36930 140 / 5e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042752 [exp] 135 / 8e-40 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.005G003900.3 pacid=42805610 polypeptide=Potri.005G003900.3.p locus=Potri.005G003900 ID=Potri.005G003900.3.v4.1 annot-version=v4.1 ATGGCTTTCAACCCAGTGACCCTAATCTTGTTTTTTCTCTCCTTAATTCCTGGGGCTACTTTGACACCCCGGACGTGTGACCCCTCGTTCAGAGGCCCAG GGCTAACTACTTACGATGTCTTCTTGAGTTTTAGAGGTGGAGATACACGCCAACATTTCACCGACCACCTCTACAAAGCTTTAACTAGAGCAGGGATTCC CACTTTCAGAGACGACGATGAGATCCGGATAGGAGAGAACATTGAGTTAGAAATCCAGAAAGCAATTCAAGAATCAAAATCATCTATTATTGTGTTTTCT AAAAACTACTCTTCTTCAAGATGGTGTCTTGATGAACTCTTGATGATCATGGAACGTAGAAGAACTGTTGGGCACTTAGTGTTCCCAGTTTTCTACGATG TTGATCCATCTGAGGTGGGGAACCAAACAGGGCAATTTGGTGAAGAATTTGCTAAGCTTGAAATACGCTTCAAGTATCAGATGGAGAGGGTGGAGGGATG GAGAAGGGCTCTTAAGGAAGCTGCAAACATGGAAAGGATGGTTCTGGAAGACAGGTATGAGTCAAAGTTCATAGAGTCGATTGTTAAAGAGATCGCAGAT AAACTCAACTTCTCACTGCCTCACGCCCCTCCGTCCTCGTTACCACTGTCGTCGGCCCTCCGCCCACCTTCATATTTTCTTTGTCTTTTACGAGAGTGGA GGTCTTTCTTTCAGACCTCCTCTCTCTTTTTATTTTTTTGA
AA sequence Show only first row Show all	>Potri.005G003900.3 pacid=42805610 polypeptide=Potri.005G003900.3.p locus=Potri.005G003900 ID=Potri.005G003900.3.v4.1 annot-version=v4.1 MAFNPVTLILFFLSLIPGATLTPRTCDPSFRGPGLTTYDVFLSFRGGDTRQHFTDHLYKALTRAGIPTFRDDDEIRIGENIELEIQKAIQESKSSIIVFS KNYSSSRWCLDELLMIMERRRTVGHLVFPVFYDVDPSEVGNQTGQFGEEFAKLEIRFKYQMERVEGWRRALKEAANMERMVLEDRYESKFIESIVKEIAD KLNFSLPHAPPSSLPLSSALRPPSYFLCLLREWRSFFQTSSLFLFF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.005G003900 [exp]	0	1
AT5G48660			B-cell receptor-associated pro...		Potri.014G191500 [exp]	1.73	0.8532
AT5G09270			unknown protein		Potri.005G066900 [exp]	1.73	0.8401
AT1G55790			Domain of unknown function (DU...		Potri.006G002700 [exp]	2.82	0.8451
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004000 [exp]	3.31	0.7984
AT2G17030			F-box family protein with a do...		Potri.001G277400 [exp]	3.46	0.8210
AT1G80530			Major facilitator superfamily ...		Potri.003G016725 [exp]	4.47	0.8004
AT5G60340			P-loop containing nucleoside t...		Potri.006G228500 [exp]	5.19	0.7601
AT5G60340			P-loop containing nucleoside t...		Potri.012G109400 [exp]	5.47	0.8249
AT4G14420			HR-like lesion-inducing protei...		Potri.002G040900 [exp]	6.78	0.7628
					Potri.003G018400 [exp]	11.31	0.8287

Compare expression of checked genes

Potri.005G003900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.