Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72930 107 / 4e-30 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72890 112 / 1e-29 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72910 110 / 3e-29 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72920 108 / 3e-29 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G17615 109 / 7e-29 Disease resistance protein (TIR-NBS class) (.1) AT1G72940 106 / 6e-28 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT4G11170 108 / 1e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72860 106 / 3e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72900 103 / 9e-27 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 102 / 4e-26 Disease resistance protein (TIR-NBS class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G004366 [exp] 253 / 1e-87 AT1G72930 114 / 1e-32 toll/interleukin-1 receptor-like (.1.2) Potri.005G004100 [exp] 196 / 9e-65 AT1G27170 122 / 3e-32 transmembrane receptors;ATP binding (.1.2) Potri.004G230000 [exp] 163 / 1e-50 AT5G36930 169 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269950 [exp] 162 / 1e-50 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004500 [exp] 158 / 5e-49 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004233 [exp] 157 / 2e-48 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.011G012000 [exp] 163 / 6e-47 AT5G36930 489 / 2e-153 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.012G135700 [exp] 162 / 8e-47 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283800 [exp] 157 / 3e-46 AT5G36930 286 / 1e-85 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 128 / 1e-34 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10011741 [exp] 127 / 3e-34 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014582 [exp] 118 / 7e-33 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10011104 [exp] 122 / 2e-32 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015453 [exp] 120 / 2e-32 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10039850 [exp] 120 / 9e-32 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10030839 [exp] 118 / 3e-31 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10018616 [exp] 117 / 7e-31 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10032101 [exp] 115 / 1e-30 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10041060 [exp] 114 / 8e-30 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.005G004000.2 pacid=42802350 polypeptide=Potri.005G004000.2.p locus=Potri.005G004000 ID=Potri.005G004000.2.v4.1 annot-version=v4.1 ATGGGTTTGTTCCCAGTTATCATTCTCTTGATGCTTTTCCTTTCTGGAAAGGCTAATGATGTTTTCTTGAGTTTTAACCACCAAGAAATTGGCAAGAATT TTGCCGATCATCTCTACAAAGACCTCAATTATGCTGGGATTCGCACTTTTAGAGATGATGGTGGAATTTACACAGGACAAAAGTCTGATGTCAAGAGAGC GATACAGGAATCCAGGATATCGGTTGTTGTGTTTTCTAAAGACTATGCTTCTTCAACAAAGTGCCTGGACCAGCTTGGGGTCATCATGGATGCTAGGAGA ACAACTGGGCTCGTTGTGCTTCCCGTTTTTTACAACGCTGATCCGTCGGAGGTCTGGGAACAGAAAGGGTTGTTTGAAGAAGCATTTGCTAAACACGAAA AAAGCTTCCATAAGGAGATGGCTAGAGTGGAAAGTTGGAGGGCCGCTCTTAAAGAAGCTGCAGACCTGAAAGGAAAGGAGCGGAAACAAGAC
AA sequence Show only first row Show all	>Potri.005G004000.2 pacid=42802350 polypeptide=Potri.005G004000.2.p locus=Potri.005G004000 ID=Potri.005G004000.2.v4.1 annot-version=v4.1 MGLFPVIILLMLFLSGKANDVFLSFNHQEIGKNFADHLYKDLNYAGIRTFRDDGGIYTGQKSDVKRAIQESRISVVVFSKDYASSTKCLDQLGVIMDARR TTGLVVLPVFYNADPSEVWEQKGLFEEAFAKHEKSFHKEMARVESWRAALKEAADLKGKERKQD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004000 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.005G003900 [exp]	3.31	0.7984
AT4G10270			Wound-responsive family protei...		Potri.019G117100 [exp]	5.65	0.7630
AT5G48660			B-cell receptor-associated pro...		Potri.014G191500 [exp]	7.87	0.7856
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Potri.005G093900 [exp]	11.22	0.7351
AT1G49170			Protein of unknown function (D...		Potri.005G056500 [exp]	11.35	0.6806
AT5G09270			unknown protein		Potri.005G066900 [exp]	13.26	0.7325
AT4G10270			Wound-responsive family protei...		Potri.019G116932 [exp]	16.12	0.7100
AT5G20810			SAUR-like auxin-responsive pro...		Potri.018G063400 [exp]	19.44	0.7608
AT2G20480			unknown protein		Potri.001G009501 [exp]	20.49	0.7067
AT1G19360		RRA3	reduced residual arabinose 3, ...		Potri.002G134400 [exp]	20.83	0.6907

Compare expression of checked genes

Potri.005G004000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.