Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72930 114 / 9e-33 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72920 115 / 8e-32 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72910 117 / 1e-31 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT4G11170 117 / 9e-31 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72890 114 / 3e-30 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72940 112 / 5e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G17615 112 / 6e-30 Disease resistance protein (TIR-NBS class) (.1) AT5G36930 112 / 4e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72900 108 / 2e-28 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 107 / 7e-28 Disease resistance protein (TIR-NBS class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G004000 [exp] 251 / 7e-87 AT1G72930 107 / 6e-30 toll/interleukin-1 receptor-like (.1.2) Potri.005G004100 [exp] 186 / 2e-60 AT1G27170 122 / 3e-32 transmembrane receptors;ATP binding (.1.2) Potri.004G230000 [exp] 168 / 2e-52 AT5G36930 169 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269950 [exp] 167 / 2e-52 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G003900 [exp] 159 / 3e-49 AT5G36930 146 / 8e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004233 [exp] 157 / 3e-48 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.011G012000 [exp] 166 / 7e-48 AT5G36930 489 / 2e-153 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T126306 [exp] 165 / 1e-47 AT3G14470 585 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.012G135700 [exp] 165 / 1e-47 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011104 [exp] 129 / 4e-35 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10018972 [exp] 123 / 6e-33 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011741 [exp] 123 / 7e-33 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 122 / 2e-32 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10039850 [exp] 122 / 2e-32 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014582 [exp] 116 / 5e-32 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10018616 [exp] 119 / 2e-31 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015453 [exp] 118 / 2e-31 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10006928 [exp] 118 / 2e-31 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006929 [exp] 112 / 7e-31 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.005G004366.1 pacid=42802750 polypeptide=Potri.005G004366.1.p locus=Potri.005G004366 ID=Potri.005G004366.1.v4.1 annot-version=v4.1 ATGGATTTGTTCTCACTTATCAATCTGTTGATGCTTCTCCTCTCCAGAAAGGATAACGATGTTTTCTTGAGTTTTAGCCACCACGACATTGGCAAGAATT TTGGTGATCATCTCTACAAAGACCTCAATTCTGCTGGGATTCGCACTCTTAGAGATGATGGTGGAATCTACGCAGGACAAAAGTCTGATATCAAGAAAGC GATACGGGAATCCAGGATATCGGTTGTTGTGTTCTCTAAAGGCTATGCTTCTTCAACAAAGTGCCTGGACCAGCTTGTGCACATCATGGATTCCAGGAAT AAAACTGGGCTCCTTGTGCTTCCCGTTTTTTACAACGTTGATCCGTCGGAGGTCAGTGAACAGAAAGGGTTGTTTGAAGAAGCATTTGCTAAACACGAAA AAAGCTTCCATAAGAAAATGGCTAGAGTGGAAAGTTGGAGGGCCGCTCTTAAAGAAGCCGCAGACCTGGCAGGAATGGTGCTGCAGCAAGACAGGTATAC AAGTAATTGA
AA sequence Show only first row Show all	>Potri.005G004366.1 pacid=42802750 polypeptide=Potri.005G004366.1.p locus=Potri.005G004366 ID=Potri.005G004366.1.v4.1 annot-version=v4.1 MDLFSLINLLMLLLSRKDNDVFLSFSHHDIGKNFGDHLYKDLNSAGIRTLRDDGGIYAGQKSDIKKAIRESRISVVVFSKGYASSTKCLDQLVHIMDSRN KTGLLVLPVFYNVDPSEVSEQKGLFEEAFAKHEKSFHKKMARVESWRAALKEAADLAGMVLQQDRYTSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004366 [exp]	0	1
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.016G001600 [exp]	1.73	0.7424
AT3G13175			unknown protein		Potri.001G366900 [exp]	6.00	0.7440
AT2G26070		RTE1	REVERSION-TO-ETHYLENE SENSITIV...		Potri.018G053900 [exp]	6.92	0.6858
AT5G50335			unknown protein		Potri.012G094000 [exp]	14.49	0.6942
AT1G14890			Plant invertase/pectin methyle...		Potri.008G132600 [exp]	15.09	0.7079
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	16.88	0.6468	SAUR6
AT1G14550			Peroxidase superfamily protein...		Potri.010G236870 [exp]	16.97	0.6302
AT5G36930			Disease resistance protein (TI...		Potri.005G004500 [exp]	25.74	0.6031
AT4G16380			Heavy metal transport/detoxifi...		Potri.006G018500 [exp]	30.51	0.6369
AT1G03010			Phototropic-responsive NPH3 fa...		Potri.014G133500 [exp]	42.07	0.6668

Compare expression of checked genes

Potri.005G004366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.