Potri.005G007100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09360 85 / 7e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G09370 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G64620 57 / 1e-10 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G49330 57 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G24370 49 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G31430 43 / 3e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G013400 67 / 6e-14 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.016G001600 61 / 1e-11 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.002G191500 47 / 9e-07 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G044100 46 / 1e-06 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G127500 44 / 1e-05 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G134900 43 / 2e-05 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G023050 39 / 0.0009 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023100 39 / 0.001 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016319 49 / 2e-07 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037791 48 / 4e-07 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017074 47 / 8e-07 AT3G17130 121 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10029877 47 / 1e-06 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10020664 45 / 4e-06 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10031483 45 / 7e-06 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10002739 44 / 1e-05 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10023215 43 / 2e-05 AT1G47960 48 / 6e-07 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10015199 41 / 0.0001 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10003530 39 / 0.0008 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.005G007100.1 pacid=42802424 polypeptide=Potri.005G007100.1.p locus=Potri.005G007100 ID=Potri.005G007100.1.v4.1 annot-version=v4.1
ATGGAGCTAGCGATCATCATTCTCTTGACCAACCCTACCTTAAGTGAAGCCCAAGATTCCCAAGTTTTAATCGACGAAGTATGTCGACAAATGGAAGACT
ATGGTTTCTGCAACAGGGTTTTTCATGAGAACATGAAAAGCCCGTCAATAGACTATGTTGGTCTCACAGCAATAGCAATGGACCAGACAATAACAAACGC
AACCAACACTTACGAGTATATTTTGGGTCTTCTAAAGAACACGACTGACCAATCATTGAGGAATGTTCTTGTTGCATGTGAGAATGCTTTTGGTATAGTG
AAGTCGTCTTTCGGGGCTGCCTTGCAATCTTTTAACAGGAAAGATTATGATGATATGTTCAAGCTTGAACGGGTTGCACCGAGAGCACAAGCCAGCTGTG
AAACGAGTTTCACTGCACCACCAAGTCCTCCAAATCCTTTGGCTGAAAGGAATAGGGAGATGAGGATTCTGATTACCATGGCTATTGCCTCTGGAAAGGA
AATACTAAAGCGTTGA
AA sequence
>Potri.005G007100.1 pacid=42802424 polypeptide=Potri.005G007100.1.p locus=Potri.005G007100 ID=Potri.005G007100.1.v4.1 annot-version=v4.1
MELAIIILLTNPTLSEAQDSQVLIDEVCRQMEDYGFCNRVFHENMKSPSIDYVGLTAIAMDQTITNATNTYEYILGLLKNTTDQSLRNVLVACENAFGIV
KSSFGAALQSFNRKDYDDMFKLERVAPRAQASCETSFTAPPSPPNPLAERNREMRILITMAIASGKEILKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G09360 Plant invertase/pectin methyle... Potri.005G007100 0 1

Potri.005G007100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.