Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	EXT.9
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25810 394 / 4e-139 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 385 / 1e-135 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57550 373 / 4e-131 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G48070 352 / 6e-123 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT4G30270 351 / 1e-122 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT2G18800 351 / 7e-122 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1) AT4G14130 349 / 2e-121 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT3G23730 348 / 7e-121 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G30280 341 / 2e-118 XTH18, ATXTH18 xyloglucan endotransglucosylase/hydrolase 18 (.1) AT4G30290 340 / 4e-118 XTH19, ATXTH19 xyloglucan endotransglucosylase/hydrolase 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G005700 [exp] 456 / 4e-163 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 415 / 1e-147 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 415 / 2e-147 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094800 [exp] 395 / 1e-139 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094900 [exp] 394 / 3e-139 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.002G060500 [exp] 380 / 9e-134 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.014G146100 [exp] 376 / 2e-132 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.005G201250 [exp] 372 / 2e-130 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201200 [exp] 365 / 2e-127 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030484 [exp] 362 / 2e-126 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Lus10000678 [exp] 360 / 6e-126 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10021638 [exp] 354 / 1e-123 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10028947 [exp] 348 / 3e-121 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10010938 [exp] 344 / 2e-119 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10010939 [exp] 342 / 1e-118 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020773 [exp] 338 / 4e-117 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031392 [exp] 337 / 1e-116 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 337 / 2e-116 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10008522 [exp] 336 / 2e-116 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.005G007200.1 pacid=42803091 polypeptide=Potri.005G007200.1.p locus=Potri.005G007200 ID=Potri.005G007200.1.v4.1 annot-version=v4.1 ATGGCTTCTTTTCTTGCTTCTTCAAGGGTTCCAATGTCGGTGGTATTGGTCTTGTTTACACTTGCTTCTTTGATGGGGTCATCTCTTGGTAACTTCTACC AAGACTTCGATATTATGTGGGGAGATTGGCGTGCTATGATACTCAACGATGGTGAGCTTCTCAATCTCAATCTTGACCAAGCTTCTGGCTCAGGATTCCA ATCCAAGAATGAGTATTTGTTCGGAAAGATTGATATGCAACTCAAGCTTGTCCCTGGCAACTCTGCTGGCACTGTAACTGCCTACTACTTACAATCAAAA GGGTCGGCCTGGGATGAGATAGACTTTGAGTTCTTGGGGAACTTGAGTGGAGATCCTTACATTCTTCATACTAATGTGTATAGCCAAGGCAAAGGCGACA AGGAGCAACAATTTTATCTCTGGTTTGATCCAACTGCTGATTTCCACACCTATTCCATCCTTTGGAACCCACAAAGAATCATCTTCTTTGTAGATGGCAC CCCTATTAGGGAGTTCAAGAACATGGAATCGATTGGTGTTCCATTTCCAAAGTATCAACCAATGAGACTCTACTCTACTTTATGGAATGCAGATAACTGG GCTACAAGAGGTGGTCTCGTCAAGACTGATTGGTCACAAGCTCCTTTCACTGCCTCCTACACGCACTTCAATGCTAATAATGCTTGTGTTTGGTTCAACG GTGCATCTTCTTGTGATTCAAATAATTTCTCCCCTCCTTCTTGGCTTTCAGAGGATCTTGATTCAGCAAATCTTGATAAGCTTCAATGGGTCCAAACGAA CAACATGATATATAATTATTGCGCAGATGCCAAGAGGTTTCCCCAGGGATTTCCTCCAGAATGCAACATGTCTTAG
AA sequence Show only first row Show all	>Potri.005G007200.1 pacid=42803091 polypeptide=Potri.005G007200.1.p locus=Potri.005G007200 ID=Potri.005G007200.1.v4.1 annot-version=v4.1 MASFLASSRVPMSVVLVLFTLASLMGSSLGNFYQDFDIMWGDWRAMILNDGELLNLNLDQASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLQSK GSAWDEIDFEFLGNLSGDPYILHTNVYSQGKGDKEQQFYLWFDPTADFHTYSILWNPQRIIFFVDGTPIREFKNMESIGVPFPKYQPMRLYSTLWNADNW ATRGGLVKTDWSQAPFTASYTHFNANNACVWFNGASSCDSNNFSPPSWLSEDLDSANLDKLQWVQTNNMIYNYCADAKRFPQGFPPECNMS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.005G007200 [exp]	0	1	EXT.9
AT5G38700			unknown protein		Potri.002G198800 [exp]	1.00	0.9007
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.002G060500 [exp]	2.00	0.8966	Pt-EXT.12
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.002G060400 [exp]	2.44	0.8904
AT5G38700			unknown protein		Potri.014G123400 [exp]	5.29	0.8284
AT4G01580	B3		AP2/B3-like transcriptional fa...		Potri.007G035700 [exp]	5.29	0.7300
AT1G45688			unknown protein		Potri.002G124600 [exp]	6.32	0.8145
AT1G76210			Arabidopsis protein of unknown...		Potri.002G012600 [exp]	12.96	0.7058
AT4G24570		DIC2	dicarboxylate carrier 2 (.1)		Potri.017G047800 [exp]	14.24	0.7696
AT5G37710			alpha/beta-Hydrolases superfam...		Potri.004G086900 [exp]	14.69	0.7029
AT1G32120			unknown protein		Potri.001G132800 [exp]	18.11	0.6791

Compare expression of checked genes

Potri.005G007200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.