Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34135 99 / 3e-26 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2) AT4G34138 99 / 4e-26 UGT73B1 UDP-glucosyl transferase 73B1 (.1) AT2G15480 97 / 3e-25 UGT73B5 UDP-glucosyl transferase 73B5 (.1.2) AT2G15490 91 / 4e-23 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3) AT4G34131 90 / 8e-23 UGT73B3 UDP-glucosyl transferase 73B3 (.1) AT3G16520 79 / 6e-19 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3) AT2G36780 77 / 5e-18 UDP-Glycosyltransferase superfamily protein (.1) AT1G07250 75 / 2e-17 UGT71C4 UDP-glucosyl transferase 71C4 (.1) AT2G36770 72 / 1e-16 UDP-Glycosyltransferase superfamily protein (.1) AT2G29740 71 / 5e-16 UGT71C2 UDP-glucosyl transferase 71C2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G010016 [exp] 159 / 3e-53 AT4G34135 102 / 4e-27 UDP-glucosyltransferase 73B2 (.1.2) Potri.001G303000 [exp] 132 / 3e-38 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1) Potri.009G098966 [exp] 129 / 3e-37 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1) Potri.001G303600 [exp] 129 / 4e-37 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1) Potri.009G099032 [exp] 121 / 3e-34 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.001G303700 [exp] 115 / 5e-32 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2) Potri.001G303300 [exp] 111 / 2e-30 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2) Potri.001G303100 [exp] 108 / 1e-29 AT2G15490 414 / 1e-141 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.001G302400 [exp] 108 / 2e-29 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019835 [exp] 110 / 3e-30 AT2G15480 476 / 3e-165 UDP-glucosyl transferase 73B5 (.1.2) Lus10014080 [exp] 105 / 6e-29 AT2G15480 330 / 3e-110 UDP-glucosyl transferase 73B5 (.1.2) Lus10014079 [exp] 106 / 1e-28 AT4G34131 483 / 3e-168 UDP-glucosyl transferase 73B3 (.1) Lus10014082 [exp] 105 / 2e-28 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2) Lus10019833 [exp] 103 / 1e-27 AT2G15480 483 / 2e-168 UDP-glucosyl transferase 73B5 (.1.2) Lus10019832 [exp] 99 / 9e-26 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3) Lus10019831 [exp] 97 / 3e-25 AT2G15490 425 / 8e-146 UDP-glycosyltransferase 73B4 (.1.2.3) Lus10014083 [exp] 94 / 3e-24 AT4G34131 489 / 2e-170 UDP-glucosyl transferase 73B3 (.1) Lus10014084 [exp] 93 / 7e-24 AT2G15490 445 / 2e-153 UDP-glycosyltransferase 73B4 (.1.2.3) Lus10014086 [exp] 92 / 2e-23 AT2G15490 496 / 4e-173 UDP-glycosyltransferase 73B4 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF00201 [poplar] [flax] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Potri.005G008050.1 pacid=42803087 polypeptide=Potri.005G008050.1.p locus=Potri.005G008050 ID=Potri.005G008050.1.v4.1 annot-version=v4.1 ATGGCAAACTTCACTGCCTCTCAGCTTAAGGAGATTGCAGCATGTCTCAAAGCTTCTGGGCATCAATTTATCTGGGTAGTTAGAAGAAGCAAAAAGGGTC AAGAAGACAAGGAAGATTGTTTACCTGAAGGATTTGAGGGAAGAATGGAAGGCAAAGGCCTAATTATTAGAGGATGGGCACTCCAAGTTTTGATTCTTGA TCATGAAGCAATAGGTGCATTTGTGACTCATTGA
AA sequence Show only first row Show all	>Potri.005G008050.1 pacid=42803087 polypeptide=Potri.005G008050.1.p locus=Potri.005G008050 ID=Potri.005G008050.1.v4.1 annot-version=v4.1 MANFTASQLKEIAACLKASGHQFIWVVRRSKKGQEDKEDCLPEGFEGRMEGKGLIIRGWALQVLILDHEAIGAFVTH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34135		UGT73B2	UDP-glucosyltransferase 73B2 (...		Potri.005G008050 [exp]	0	1
AT4G10590		UBP10	ubiquitin-specific protease 10...		Potri.016G067400 [exp]	3.46	0.9174
AT4G34135		UGT73B2	UDP-glucosyltransferase 73B2 (...		Potri.005G010016 [exp]	6.00	0.9401
					Potri.001G255904 [exp]	10.86	0.9202
					Potri.017G115002 [exp]	22.97	0.8963
AT3G11310			unknown protein		Potri.010G022201 [exp]	24.37	0.9101
AT1G30760			FAD-binding Berberine family p...		Potri.011G161400 [exp]	34.29	0.8566
					Potri.006G174801 [exp]	40.98	0.9066
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Potri.012G069300 [exp]	43.12	0.7924	ATHVA22.1
AT3G53810			Concanavalin A-like lectin pro...		Potri.009G035400 [exp]	46.88	0.8054
AT1G27440		ATGUT1, IRX10, ...	Exostosin family protein (.1)		Potri.003G162000 [exp]	51.75	0.8138

Compare expression of checked genes

Potri.005G008050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.