Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35635 110 / 1e-32 UBQ7, RUB2 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) AT1G31340 110 / 2e-32 NEDD8, ATRUB1, RUB1 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) AT4G05050 109 / 4e-32 UBQ11 ubiquitin 11 (.1.2.3.4) AT5G37640 111 / 2e-31 UBQ9 ubiquitin 9 (.1) AT1G55060 109 / 2e-31 UBQ12 ubiquitin 12 (.1) AT2G36170 107 / 2e-31 Ubiquitin supergroup;Ribosomal protein L40e (.1) AT3G52590 107 / 2e-31 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G47110 107 / 2e-31 UBQ6 ubiquitin 6 (.1.2) AT1G23410 107 / 2e-31 Ribosomal protein S27a / Ubiquitin family protein (.1) AT3G62250 107 / 2e-31 UBQ5 ubiquitin 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G198700 [exp] 110 / 2e-32 AT1G31340 293 / 1e-103 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.002G062500 [exp] 110 / 2e-32 AT1G31340 296 / 9e-105 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.016G077000 [exp] 108 / 2e-32 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.005G096700 [exp] 108 / 1e-31 AT1G31340 270 / 2e-94 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.014G115100 [exp] 107 / 2e-31 AT2G47110 255 / 2e-88 ubiquitin 6 (.1.2) Potri.015G111500 [exp] 107 / 2e-31 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.002G190000 [exp] 107 / 2e-31 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.012G114000 [exp] 107 / 2e-31 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.001G025300 [exp] 107 / 2e-31 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008873 [exp] 107 / 2e-31 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10018367 [exp] 109 / 3e-31 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6) Lus10030894 [exp] 107 / 3e-31 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10030595 [exp] 107 / 3e-31 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10018538 [exp] 44 / 9e-07 AT2G35635 51 / 6e-09 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) Lus10008806 [exp] 44 / 2e-06 AT5G23740 282 / 1e-89 ribosomal protein S11-beta (.1) Lus10040001 [exp] 44 / 2e-06 AT5G25270 328 / 3e-102 Ubiquitin-like superfamily protein (.1) Lus10010493 [exp] 42 / 9e-06 AT4G12570 830 / 0.0 ubiquitin protein ligase 5 (.1) Lus10034563 [exp] 42 / 1e-05 AT5G42220 444 / 3e-148 Ubiquitin-like superfamily protein (.1) Lus10013082 [exp] 38 / 0.0002 AT1G23410 56 / 3e-12 Ribosomal protein S27a / Ubiquitin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF00240 [poplar] [flax] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Potri.005G011700.1 pacid=42803017 polypeptide=Potri.005G011700.1.p locus=Potri.005G011700 ID=Potri.005G011700.1.v4.1 annot-version=v4.1 ATGCAGATATTTGTGAGAACCCTGAGACTCAAAACCATCACCCTTGATGTTGAAAGCTCCGAGACAATCGAAGACTTGAAAGCAAAAATCTATGAGAAGG AATTAGGCATCCGTCCTGAGAACCAACGTCTCATATATTGTGGAAAGCAATTAGAGGAAGGAAAAACCCTGTCAGATTACAACATCCAGAAGAACTCCAC TATCCACCATGTTCTTAGGCTTTGTGGCGGCGGCATGCAGCAAGCCTTTTATTGA
AA sequence Show only first row Show all	>Potri.005G011700.1 pacid=42803017 polypeptide=Potri.005G011700.1.p locus=Potri.005G011700 ID=Potri.005G011700.1.v4.1 annot-version=v4.1 MQIFVRTLRLKTITLDVESSETIEDLKAKIYEKELGIRPENQRLIYCGKQLEEGKTLSDYNIQKNSTIHHVLRLCGGGMQQAFY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35635		UBQ7, RUB2	RELATED TO UBIQUITIN 2, ubiqui...		Potri.005G011700 [exp]	0	1
AT4G35280	C2H2ZnF	DAZ2	DUO1-ACTIVATED ZINC FINGER 2, ...		Potri.009G166200 [exp]	7.93	0.6367
AT1G49390			2-oxoglutarate (2OG) and Fe(II...		Potri.018G121750 [exp]	15.62	0.7231
AT3G09440			Heat shock protein 70 (Hsp 70)...		Potri.008G054766 [exp]	26.53	0.6597
AT3G46620			zinc finger (C3HC4-type RING f...		Potri.006G164516 [exp]	36.85	0.6905
					Potri.003G108601 [exp]	60.13	0.6442
AT1G05410			Protein of unknown function (D...		Potri.010G086600 [exp]	61.59	0.6472
AT2G45630			D-isomer specific 2-hydroxyaci...		Potri.003G119000 [exp]	71.20	0.6154

Compare expression of checked genes

Potri.005G011700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.