Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10500 235 / 4e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 234 / 1e-74 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 229 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 201 / 9e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 189 / 8e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G38240 187 / 2e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 185 / 1e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 185 / 2e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 184 / 5e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 182 / 1e-54 ATSRG1, SRG1 senescence-related gene 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G223000 [exp] 442 / 1e-156 AT4G10500 238 / 3e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G039500 [exp] 411 / 4e-144 AT4G10500 244 / 1e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G039600 [exp] 336 / 3e-115 AT4G10500 194 / 8e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 254 / 2e-82 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451700 [exp] 252 / 8e-82 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 250 / 6e-81 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 249 / 2e-80 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 248 / 6e-80 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 242 / 8e-78 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000711 [exp] 340 / 3e-116 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 338 / 2e-115 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 276 / 3e-91 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 246 / 3e-79 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 242 / 6e-78 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 234 / 1e-74 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 201 / 2e-61 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 199 / 4e-61 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 195 / 5e-59 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 189 / 1e-56 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.005G013600.1 pacid=42803696 polypeptide=Potri.005G013600.1.p locus=Potri.005G013600 ID=Potri.005G013600.1.v4.1 annot-version=v4.1 ATGGAGAAGCTCGTTTCAAGCTGGAACAATGTCCAAACCGTGCCTGAGAAGTACATTTTTCCACCGGAAAAGCGACCAGGGAATGTCACTTTCAATGCAA GCAAGTCCATACCAGTTATAGATCTTGAAGCAATAGCCATTAGTCAAGATAGAGATGCTACTATACAAAAAATTCTGAAAGCTGGTCAAGATTATGGATT TTTTCAGGTGATCAATCATGGCGTCGCTGAAGATTTGATGAATGACACAATGAGTGTCTTCAAGGAATTCTTTGAGTTGCCTGAAGAGGACAAGACAAGC TTCTACTGCGAGGATGCAATGAGAAACAATCATTGCATTTTGTATACAAGTAGTTTACTTTATGCTACTGAAGATGTTCACTTATGGCGAGATAATTTAA GGAACTCTTGTCATCCTCTAGAGGAATGCATTCAACACTGGCCCGAAAAACCAACAAGATACCGACATGTTGTCGGGGCTTATGCTACTGAAGTAAAAAA ACTGGCTGCAACAATCTTGGAGTTACTTTGTGAAGGACTGGGGTTGGAGTCTGGGCATTTTGGGGGTAAGCTCAGTGAAATCCCAAGTTTGTTAGTCAAT CATTATCCACCATGCCCAGATCCAAGTTTGACCCTCGGAGTCTCCGAACACTGTGATCCTAATCTCATAACCATTTTACAACAAGATAGTGATGTGTTTG GGCTTCAAGTCTTAAAGAATGGTGAATGGATTGGTGTTGAGCCAATTTCTAATGCATTTGTGGTTAACATGGGATACCAAATGCAGATTGTCAGTAACAA CAAGCTGAGAAGCGTCGAACATCGAGCAGTGACAAATTCAGAGAAAGCTCGGACAAGTGTTGCCATGTTTTTCATTCCTAATGGTGACAGCATTGTAGAG CCTGCCAAAGCTCTTGTTGATCCACGCAATCCTGCAATCTATAAATCCTTTCAGTATAAAGAGTTCATGTCCCATTTCTTGAAAAAGACTGGTGGCACTG ATGTCGCCTTGGAGGCTTTTAAGCTGCAGGCTAATTAG
AA sequence Show only first row Show all	>Potri.005G013600.1 pacid=42803696 polypeptide=Potri.005G013600.1.p locus=Potri.005G013600 ID=Potri.005G013600.1.v4.1 annot-version=v4.1 MEKLVSSWNNVQTVPEKYIFPPEKRPGNVTFNASKSIPVIDLEAIAISQDRDATIQKILKAGQDYGFFQVINHGVAEDLMNDTMSVFKEFFELPEEDKTS FYCEDAMRNNHCILYTSSLLYATEDVHLWRDNLRNSCHPLEECIQHWPEKPTRYRHVVGAYATEVKKLAATILELLCEGLGLESGHFGGKLSEIPSLLVN HYPPCPDPSLTLGVSEHCDPNLITILQQDSDVFGLQVLKNGEWIGVEPISNAFVVNMGYQMQIVSNNKLRSVEHRAVTNSEKARTSVAMFFIPNGDSIVE PAKALVDPRNPAIYKSFQYKEFMSHFLKKTGGTDVALEAFKLQAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.005G013600 [exp]	0	1
AT5G14650			Pectin lyase-like superfamily ...		Potri.001G346800 [exp]	12.00	0.9503
AT1G12100			Bifunctional inhibitor/lipid-t...		Potri.001G121800 [exp]	14.38	0.9430
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Potri.001G069650 [exp]	18.84	0.9422
AT2G23440			unknown protein		Potri.007G041500 [exp]	19.26	0.9387
AT1G64780		ATAMT1;2	ammonium transporter 1;2 (.1)		Potri.019G023600 [exp]	19.49	0.9425
AT2G39510			nodulin MtN21 /EamA-like trans...		Potri.010G209200 [exp]	22.27	0.7974
AT2G41660		MIZ1	mizu-kussei 1, Protein of unkn...		Potri.016G056800 [exp]	22.69	0.8841
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Potri.004G156300 [exp]	25.09	0.9375
AT5G43180			Protein of unknown function, D...		Potri.016G137800 [exp]	26.32	0.8865
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.002G039600 [exp]	29.39	0.9383

Compare expression of checked genes

Potri.005G013600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.