Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23260 70 / 1e-15 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2) AT4G23250 65 / 6e-14 RKC1, CRK17, DUF26-21, EMB1290 RECEPTOR-LIKE KINASE THALIANACOL-0GENOMICLIBRARY\(CLONTECH\).THEPOSITIVEPHAGECLONES C-X8-C-X2-C CLASS 1, EMBRYO DEFECTIVE 1290, CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 17, kinases;protein kinases (.1) AT4G11470 65 / 6e-14 CRK31 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1) AT4G11480 65 / 7e-14 CRK32 cysteine-rich RLK (RECEPTOR-like protein kinase) 32 (.1) AT4G23150 65 / 7e-14 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23240 64 / 7e-14 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1) AT4G23270 64 / 9e-14 CRK19 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) AT4G23140 64 / 2e-13 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23300 64 / 2e-13 CRK22 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1) AT4G23230 63 / 2e-13 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G014700 [exp] 117 / 3e-32 AT4G21390 671 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.005G014900 [exp] 116 / 5e-32 AT4G21390 660 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.005G014802 [exp] 114 / 8e-32 AT1G11330 454 / 5e-152 S-locus lectin protein kinase family protein (.1.2) Potri.001G134900 [exp] 100 / 2e-26 AT4G21390 662 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G027501 [exp] 73 / 7e-17 AT4G23180 553 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.019G119700 [exp] 72 / 1e-16 AT4G03230 1025 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119851 [exp] 71 / 1e-16 AT4G03230 325 / 1e-104 S-locus lectin protein kinase family protein (.1) Potri.004G023964 [exp] 72 / 3e-16 AT4G23180 401 / 6e-132 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024140 [exp] 71 / 5e-16 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038411 [exp] 65 / 6e-14 AT1G11330 308 / 1e-98 S-locus lectin protein kinase family protein (.1.2) Lus10023391 [exp] 65 / 7e-14 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10006745 [exp] 64 / 2e-13 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007602 [exp] 63 / 3e-13 AT1G65800 788 / 0.0 receptor kinase 2 (.1) Lus10018405 [exp] 63 / 3e-13 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10009583 [exp] 61 / 3e-13 AT4G23310 164 / 2e-47 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10020083 [exp] 61 / 1e-12 AT4G21390 427 / 6e-143 S-locus lectin protein kinase family protein (.1) Lus10006746 [exp] 61 / 2e-12 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033752 [exp] 61 / 3e-12 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1) Lus10020080 [exp] 61 / 3e-12 AT4G21390 730 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G014950.1 pacid=42803643 polypeptide=Potri.005G014950.1.p locus=Potri.005G014950 ID=Potri.005G014950.1.v4.1 annot-version=v4.1 ATGCAACTTTGCGTTGTTATACCATTGGCATGGAAGTTATGGAAATATTCTAATAAAGCTTTGGACTGGATGGATCCAAGCCTGGGAGATCCTCCTTCAA CTTCTATGCTGTTGAGATACATAAACATAGGACTCCTTTGTGTCCAAGAAATTCCTGCTGATCGGCCTACAATGTCTGATGTCATCTCCATGATTGTAAA GGACCGCGTATCTCTCCCGGAACCCTAG
AA sequence Show only first row Show all	>Potri.005G014950.1 pacid=42803643 polypeptide=Potri.005G014950.1.p locus=Potri.005G014950 ID=Potri.005G014950.1.v4.1 annot-version=v4.1 MQLCVVIPLAWKLWKYSNKALDWMDPSLGDPPSTSMLLRYINIGLLCVQEIPADRPTMSDVISMIVKDRVSLPEP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23260		CRK18	cysteine-rich RLK (RECEPTOR-li...		Potri.005G014950 [exp]	0	1
AT3G50470		MLA10, HR3	INTRACELLULAR MILDEW A 10, hom...		Potri.007G038600 [exp]	3.74	0.8585
AT1G65820			microsomal glutathione s-trans...		Potri.017G140900 [exp]	6.63	0.9105
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Potri.005G187600 [exp]	7.54	0.9085
AT4G34950			Major facilitator superfamily ...		Potri.005G112400 [exp]	8.00	0.8985
AT4G37760		SQE3	squalene epoxidase 3 (.1)		Potri.012G120676 [exp]	10.67	0.8897
AT4G38260			Protein of unknown function (D...		Potri.005G252250 [exp]	11.53	0.8799
					Potri.004G148100 [exp]	12.44	0.8921
AT1G52190			Major facilitator superfamily ...		Potri.018G041400 [exp]	12.96	0.8740
AT1G52190			Major facilitator superfamily ...		Potri.018G040500 [exp]	15.19	0.8690
AT2G44310			Calcium-binding EF-hand family...		Potri.002G218775 [exp]	18.70	0.8701

Compare expression of checked genes

Potri.005G014950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.