Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G014700 [exp] 77 / 4e-18 AT4G21390 671 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.005G014900 [exp] 73 / 8e-17 AT4G21390 660 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125351 [exp] 37 / 0.0004 AT4G27290 748 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125151 [exp] 36 / 0.001 AT4G27290 757 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G134900 [exp] 0 / 1 AT4G21390 662 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039733 [exp] 41 / 2e-05 AT4G27290 615 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039731 [exp] 40 / 5e-05 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10033748 [exp] 38 / 0.0003 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039767 [exp] 37 / 0.0004 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10031596 [exp] 37 / 0.0004 AT2G19130 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10042266 [exp] 37 / 0.0005 AT2G19130 775 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G015300.1 pacid=42803865 polypeptide=Potri.005G015300.1.p locus=Potri.005G015300 ID=Potri.005G015300.1.v4.1 annot-version=v4.1 ATGAAAAACGGACTGCTTCCATTTGGGTCTTTCCCAATTGACAACATACCTGGTGCAGGAACTTCTGAGTTTTTCCAGGAAATAAGCCGCTTCACTTGCC CAGTGTACTTGTTAATTCCATGCTTTCCACCAGGTAGCATGTATCAGTTGGATTGTCAAAACTCTGCCAATAAATGGCAGATGGATTTGAGCCATCTCTT ACGACAATGTATCTGCTGTACTAGTATTCGGCATTGA
AA sequence Show only first row Show all	>Potri.005G015300.1 pacid=42803865 polypeptide=Potri.005G015300.1.p locus=Potri.005G015300 ID=Potri.005G015300.1.v4.1 annot-version=v4.1 MKNGLLPFGSFPIDNIPGAGTSEFFQEISRFTCPVYLLIPCFPPGSMYQLDCQNSANKWQMDLSHLLRQCICCTSIRH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G18470			Curculin-like (mannose-binding...		Potri.005G015300 [exp]	0	1
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014338 [exp]	2.64	0.8609
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014380 [exp]	4.00	0.8497
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014308 [exp]	6.32	0.8328
AT5G17680			disease resistance protein (TI...		Potri.019G069200 [exp]	6.92	0.8559
AT1G08440			Aluminium activated malate tra...		Potri.009G017900 [exp]	12.24	0.7716
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014304 [exp]	12.96	0.7806
AT1G65840		ATPAO4	polyamine oxidase 4 (.1)		Potri.004G075800 [exp]	15.09	0.7054
AT5G38344			Toll-Interleukin-Resistance (T...		Potri.013G097600 [exp]	18.13	0.7413
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014374 [exp]	18.54	0.8351
AT4G32060			calcium-binding EF hand family...		Potri.018G118008 [exp]	19.33	0.7614

Compare expression of checked genes

Potri.005G015300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.