Potri.005G019200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56320 130 / 5e-39 unknown protein
AT5G49350 124 / 6e-36 Glycine-rich protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G108400 130 / 1e-38 AT5G49350 138 / 9e-41 Glycine-rich protein family (.1.2)
Potri.013G158300 45 / 3e-06 AT5G49350 44 / 1e-05 Glycine-rich protein family (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016857 115 / 5e-32 AT5G49350 138 / 3e-40 Glycine-rich protein family (.1.2)
Lus10037727 114 / 4e-31 AT5G49350 136 / 1e-38 Glycine-rich protein family (.1.2)
Lus10031407 102 / 2e-27 ND 85 / 1e-20
Lus10010927 95 / 4e-23 AT1G56140 343 / 2e-107 Leucine-rich repeat transmembrane protein kinase (.1)
Lus10041125 82 / 1e-19 AT5G49350 99 / 2e-25 Glycine-rich protein family (.1.2)
Lus10034447 41 / 6e-05 AT5G49350 41 / 9e-05 Glycine-rich protein family (.1.2)
Lus10019112 40 / 0.0002 ND 40 / 2e-04
PFAM info
Representative CDS sequence
>Potri.005G019200.1 pacid=42804458 polypeptide=Potri.005G019200.1.p locus=Potri.005G019200 ID=Potri.005G019200.1.v4.1 annot-version=v4.1
ATGGCAATCTTAGCTTTGCCAAAACTAAAATTCCTTGCCTTCATGACTCTAATTTTCATGGCCAGATTGTGCTGCTACACAGGATATGCTCAGGTTGTCC
CCGGACAGATGGTTGCTAAAGCATTGTTGTGTTTGAATAACAAGATTATTTATTCAGGATGTGACGAGGCATATAGATTAACACAGAGTGGGAATCTTAA
TGTACCTCCTGAAGCAACTGAACTATTCTGTAATGGACCTTGCTTAGCTGAGACAAGATTAGCGCTGAGTTGCATTAATGATGTGATATCAGATTTTCTT
TTCTATAATAAGGCTACTGTAAGAGACATAAATTATGCGCTGAGTGCTGGTTGCAGCTCCACTAGGCAAAGAGGTGACTTCAATGTGGCAAGGTACATCA
ATGGTGAAACAAGTAGTGCATCAAGCTTGCCCAACTTGATTGGATTCTATGCCTTGGCTTTGTTTATTTGGTGGTGGATATTGCTCTTGTAA
AA sequence
>Potri.005G019200.1 pacid=42804458 polypeptide=Potri.005G019200.1.p locus=Potri.005G019200 ID=Potri.005G019200.1.v4.1 annot-version=v4.1
MAILALPKLKFLAFMTLIFMARLCCYTGYAQVVPGQMVAKALLCLNNKIIYSGCDEAYRLTQSGNLNVPPEATELFCNGPCLAETRLALSCINDVISDFL
FYNKATVRDINYALSAGCSSTRQRGDFNVARYINGETSSASSLPNLIGFYALALFIWWWILLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G56320 unknown protein Potri.005G019200 0 1
AT4G26200 ACS7, ATACS7 1-amino-cyclopropane-1-carboxy... Potri.018G067000 2.82 0.9283 Pt-ACS3.2
AT4G04745 unknown protein Potri.011G002100 4.58 0.9026
AT1G14700 PAP3, ATPAP3 purple acid phosphatase 3 (.1.... Potri.008G139100 4.89 0.9113 Pt-PAP8.3
AT3G46540 ENTH/VHS family protein (.1) Potri.008G055600 4.89 0.9252
AT3G09390 ATMT-K, ATMT-1,... ARABIDOPSIS THALIANA METALLOTH... Potri.013G131200 5.83 0.9256
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Potri.009G076900 9.16 0.9073
AT4G17340 TIP2;2, DELTA-T... tonoplast intrinsic protein 2;... Potri.003G077800 12.36 0.8961 Pt-TIP2.5
AT1G03430 AHP5 histidine-containing phosphotr... Potri.014G136200 12.36 0.8871 Pt-HPT2.1
AT2G38870 Serine protease inhibitor, pot... Potri.006G212000 15.90 0.8915
AT3G22060 Receptor-like protein kinase-r... Potri.007G120300 16.88 0.9110

Potri.005G019200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.