Potri.005G020900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05700 238 / 1e-79 Drought-responsive family protein (.1)
AT5G26990 229 / 4e-76 Drought-responsive family protein (.1)
AT1G56280 172 / 3e-54 ATDI19 drought-induced 19 (.1.2)
AT3G06760 161 / 1e-49 Drought-responsive family protein (.1.2)
AT5G49230 151 / 7e-46 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
AT4G02200 112 / 2e-30 Drought-responsive family protein (.1.2.3)
AT1G02750 107 / 2e-28 Drought-responsive family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G011200 357 / 7e-127 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1)
Potri.010G000800 209 / 2e-68 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.008G213400 197 / 7e-64 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.014G125500 157 / 4e-48 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1)
Potri.002G200500 157 / 7e-48 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1)
Potri.011G057200 110 / 8e-30 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2)
Potri.019G027300 100 / 2e-27 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.012G086500 86 / 1e-20 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031467 290 / 4e-100 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1)
Lus10015214 230 / 5e-77 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1)
Lus10037819 167 / 7e-52 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10001462 131 / 6e-38 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1)
Lus10013420 129 / 3e-37 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2)
Lus10010305 115 / 7e-32 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2)
Lus10017097 112 / 7e-31 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10015412 106 / 6e-28 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1)
Lus10037717 100 / 3e-24 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1)
Lus10002441 88 / 3e-22 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF14571 Di19_C Stress-induced protein Di19, C-terminal
Representative CDS sequence
>Potri.005G020900.1 pacid=42805675 polypeptide=Potri.005G020900.1.p locus=Potri.005G020900 ID=Potri.005G020900.1.v4.1 annot-version=v4.1
ATGGATGCTGATTCATGGAGTGCTCGACTTTCCTCAGCTTCTAAGAGATACCAATCAGCTCTTCAATCACGATCTGATATGTTTATGGGGTTTGAAGAAA
TTGATGGAGATGATGATATAAGGGAGGAGTTTCCGTGCCCTTTCTGTTCTGAATATTTTGATATTGTTGGGTTGTGTTGTCACATTGATGATGAGCATAC
CATGGAATCCAAGAATGGGGTTTGCCCAATTTGTGCAATGAGGGTGAGTGTTGACATGGTTGCGCATATAACCCTACAACATGGAAACATATTCAAGATG
CAGCGCAAGAGGAAATCACGTAGAGGTGGACCTCATTCAACCCTTTCTTTATTGAGGAAAGAGTTGAGAGAAGGGAATCTACAGTCCCTTTTAGGCGGTT
CTTCCTGTATAGTTTCCTCGTCCAATTCCGCACCTGATCCGTTATTGTCTTCATTCATTTTACCCATGGCTGATGATCTCACAAGTTCTCAGCCTTCTTT
TTTGTCTGAAACAAGCGTGGCCAAGAAAAGTTCGGTTGGGAATGTTTCAGAACGAAACAAGAAGTCACCTCCCATGTCAATTAAGGACAAGGAAGAGAAG
GCCAAAAGGAGTGAGTTTGTACAAGGGCTGTTGTTGTCTACAATTCTCGATGATATTTTATAG
AA sequence
>Potri.005G020900.1 pacid=42805675 polypeptide=Potri.005G020900.1.p locus=Potri.005G020900 ID=Potri.005G020900.1.v4.1 annot-version=v4.1
MDADSWSARLSSASKRYQSALQSRSDMFMGFEEIDGDDDIREEFPCPFCSEYFDIVGLCCHIDDEHTMESKNGVCPICAMRVSVDMVAHITLQHGNIFKM
QRKRKSRRGGPHSTLSLLRKELREGNLQSLLGGSSCIVSSSNSAPDPLLSSFILPMADDLTSSQPSFLSETSVAKKSSVGNVSERNKKSPPMSIKDKEEK
AKRSEFVQGLLLSTILDDIL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05700 Drought-responsive family prot... Potri.005G020900 0 1
AT5G56140 RNA-binding KH domain-containi... Potri.011G168000 1.00 0.8087
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Potri.016G017500 2.00 0.7807
AT5G54540 Uncharacterised conserved prot... Potri.011G130000 2.23 0.7628
AT3G24200 FAD/NAD(P)-binding oxidoreduct... Potri.001G051200 2.64 0.7555
AT5G10860 CBSX3 CBS domain containing protein ... Potri.013G161500 4.69 0.7490
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Potri.016G034875 4.89 0.7577
AT4G39100 SHL1 short life, PHD finger family ... Potri.004G159900 5.74 0.7689
AT2G05830 NagB/RpiA/CoA transferase-like... Potri.006G219900 7.54 0.7322
AT3G26420 ATRZ-1A RZ-1A, RNA-binding (RRM/RBD/RN... Potri.001G207100 10.67 0.6967
AT1G69010 bHLH bHLH102, BIM2 BES1-interacting Myc-like prot... Potri.004G112900 10.81 0.7479

Potri.005G020900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.