Potri.005G023050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G48010 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G023100 631 / 0 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023201 629 / 0 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G134900 55 / 8e-09 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.003G086600 55 / 1e-08 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.004G016500 54 / 1e-08 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G044100 52 / 1e-07 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086500 51 / 3e-07 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 46 / 6e-06 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G013400 46 / 6e-06 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029877 70 / 4e-14 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10015199 69 / 9e-14 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10020664 67 / 2e-13 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10031483 66 / 1e-12 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017345 52 / 1e-07 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1)
Lus10017076 46 / 8e-06 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 45 / 2e-05 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037791 42 / 0.0003 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037792 41 / 0.0004 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.005G023050.1 pacid=42802835 polypeptide=Potri.005G023050.1.p locus=Potri.005G023050 ID=Potri.005G023050.1.v4.1 annot-version=v4.1
ATGGGTTCTTTACATGGGCTCATTCCATTTTGCCTTGTCCTAGTTCTTGTCCTCTCTTCCAATCATCTCATTGCTAAAGCCCACAAAAATTCCACGAATC
AAATCAAAGTAGAAGCTGATTTCAAAATCATAGCCGAACTTGCAGGAAAGAATGCAATTCCAAACGCTGATTTCAAAGGCCTAGCCAAGCTTGCATTAAC
GAAAGCAATATCAAATGGGAATGCAATATACCACCGCGTCAACTCGTTGCTACTCAAAACTTCGGACATGTACACTACGAGAAGCCTAACAGGTTGTTCT
ACCAACTACAAAGATGCAGTTGGCCTTATTAACAAATCGCTGGCTGCTTTGGATGCTAAAAATTACGATGATGCCAAGACATGTATCACGGACGCCTTGG
CGAACTCAACGAAATGCGAAGATAGATTCGAGGAACTATTACAACGAAATTCCCCATTTACATTCATGAAAGCTAAGTTTGACCTGCTATGCTTGAGTGG
TTTAAAACACATCAATCTGTTAGTCCAGAAGGAACGCTTGATAACTGAAGGTTGTAGCCAAACCTTAGACAAGGAGCTGTGCAAATCTACAGTCGTATTC
TTCCTGGAAAACAAAGGACTTCGTCTCCAAGGCATAGCCAAGCTTGCAGTAAAGAAAGCATTGCAAGATGGCACCAGAATCCACAACCACATCAGTGTGT
TGCTAAAAACAACTTCAGATCAATGCGTTCTGAAAAAACTCAAAAGTTGTTCTGCGTTCTACCTGACTGCAATTGAAAAGATTAAGGAGTCGCTGCCAGC
TTTGGATTGTAATCGTTATGGTGATGCCAGTACATGGGTTGGAGCTGCCATAGACTCGGCGGAGACATGCGAGGGTGTGTTTGCTGGAAAATCAAACACG
ATATCTCCTTTGACCCCTATGAAAATAGAGTTTAGTAAGCAAGTCTCTATTTCTTTAGTTGTCATCAAAAAGCTAGCCGGAAATTAA
AA sequence
>Potri.005G023050.1 pacid=42802835 polypeptide=Potri.005G023050.1.p locus=Potri.005G023050 ID=Potri.005G023050.1.v4.1 annot-version=v4.1
MGSLHGLIPFCLVLVLVLSSNHLIAKAHKNSTNQIKVEADFKIIAELAGKNAIPNADFKGLAKLALTKAISNGNAIYHRVNSLLLKTSDMYTTRSLTGCS
TNYKDAVGLINKSLAALDAKNYDDAKTCITDALANSTKCEDRFEELLQRNSPFTFMKAKFDLLCLSGLKHINLLVQKERLITEGCSQTLDKELCKSTVVF
FLENKGLRLQGIAKLAVKKALQDGTRIHNHISVLLKTTSDQCVLKKLKSCSAFYLTAIEKIKESLPALDCNRYGDASTWVGAAIDSAETCEGVFAGKSNT
ISPLTPMKIEFSKQVSISLVVIKKLAGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G46940 Plant invertase/pectin methyle... Potri.005G023050 0 1
AT5G46940 Plant invertase/pectin methyle... Potri.005G023100 1.41 0.9476
AT5G46940 Plant invertase/pectin methyle... Potri.005G023201 2.00 0.9406
Potri.011G134400 13.26 0.8379
Potri.001G422750 14.96 0.8298
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Potri.001G080000 15.49 0.8727
AT3G26750 unknown protein Potri.007G019733 16.06 0.7746
AT2G01570 GRAS RGA1 REPRESSOR OF GA1-3 1, REPRESSO... Potri.017G018801 16.88 0.8729
AT3G13850 AS2 LBD22 LOB domain-containing protein ... Potri.003G039700 17.23 0.8544
AT3G54490 RPB5E "RNA polymerase II fifth large... Potri.003G200450 17.88 0.8587
AT5G05800 unknown protein Potri.008G074066 24.45 0.8378

Potri.005G023050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.