Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56220 86 / 3e-23 Dormancy/auxin associated family protein (.1.2.3.4) AT1G54070 47 / 6e-08 Dormancy/auxin associated family protein (.1) AT1G28330 43 / 2e-06 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G014900 [exp] 113 / 7e-34 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4) Potri.003G070500 [exp] 59 / 2e-12 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1) Potri.001G164800 [exp] 53 / 3e-10 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1) Potri.004G047100 [exp] 47 / 1e-07 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031488 [exp] 91 / 7e-25 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4) Lus10020661 [exp] 89 / 4e-24 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4) Lus10015193 [exp] 88 / 1e-23 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4) Lus10029881 [exp] 90 / 1e-22 AT5G27830 245 / 9e-80 unknown protein Lus10008142 [exp] 46 / 2e-07 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1) Lus10025446 [exp] 44 / 7e-07 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2) Lus10013180 [exp] 45 / 8e-07 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1) Lus10013996 [exp] 42 / 5e-06 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015418 [exp] 42 / 6e-06 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10013997 [exp] 42 / 6e-06 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05564 [poplar] [flax] Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence Show only first row Show all	>Potri.005G024250.1 pacid=42805172 polypeptide=Potri.005G024250.1.p locus=Potri.005G024250 ID=Potri.005G024250.1.v4.1 annot-version=v4.1 ATGAGCCTTCTCGATCAGCTCTGGGACGACACCGTTGCCGGTCCCCTTCCGGAAAGCGGTCTCGGCAAGCTCCGGAAGATGCCGAGCTTGGGCCTCCGGC CAAACCCCGGCAAGGAGTCAGGCGGCGGCGGCGTGATGAGATCGCACAGTGAGGAAGCGACGACGGTTGATGAGAAGAGAGTGACACGGAGTATCATGAT AGTAAGACCACCGGGGTACACTAATGGTTCGTCTACTACACCGCCGGCTTCACCAGCTGGATCGACCCCTCCCGTGTCTCCTTTTCCTGATTGA
AA sequence Show only first row Show all	>Potri.005G024250.1 pacid=42805172 polypeptide=Potri.005G024250.1.p locus=Potri.005G024250 ID=Potri.005G024250.1.v4.1 annot-version=v4.1 MSLLDQLWDDTVAGPLPESGLGKLRKMPSLGLRPNPGKESGGGGVMRSHSEEATTVDEKRVTRSIMIVRPPGYTNGSSTTPPASPAGSTPPVSPFPD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G56220			Dormancy/auxin associated fami...		Potri.005G024250 [exp]	0	1
AT2G46270	bZIP	GBF3	G-box binding factor 3 (.1.2)		Potri.002G167100 [exp]	1.73	0.7285	Pt-GBF3.2
AT1G33440			Major facilitator superfamily ...		Potri.019G067500 [exp]	4.47	0.7596
AT4G35790		ATPLDDELTA	ARABIDOPSIS THALIANA PHOSPHOLI...		Potri.005G246000 [exp]	7.48	0.7464
AT3G25910			Protein of unknown function (D...		Potri.018G070500 [exp]	12.48	0.7267
AT4G28240			Wound-responsive family protei...		Potri.019G116300 [exp]	14.28	0.7080
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024200 [exp]	18.02	0.7093	CHIB1.1
AT5G64730			Transducin/WD40 repeat-like su...		Potri.001G306500 [exp]	18.76	0.6720
AT3G05700			Drought-responsive family prot...		Potri.005G020900 [exp]	19.23	0.6974
AT5G35410		ATSOS2, CIPK24,...	SNF1-RELATED PROTEIN KINASE 3....		Potri.006G068400 [exp]	24.97	0.6400	Pt-CIPK24.1
AT5G25270			Ubiquitin-like superfamily pro...		Potri.006G059700 [exp]	25.69	0.6941

Compare expression of checked genes

Potri.005G024250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.