Potri.005G030413 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20142 132 / 5e-38 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT4G16990 136 / 9e-38 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
AT1G65850 135 / 3e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT4G12010 135 / 4e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G45060 134 / 8e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44480 132 / 4e-36 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G16860 132 / 4e-36 RPP5, RPP4 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44630 130 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
AT3G44400 130 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT3G04220 130 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G030318 320 / 3e-102 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G030700 320 / 6e-102 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G031101 306 / 3e-98 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.005G032000 263 / 5e-92 AT2G20142 127 / 9e-37 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Potri.004G088500 263 / 6e-82 AT1G69550 647 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G062700 199 / 9e-66 AT4G16990 149 / 1e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
Potri.019G068200 185 / 8e-55 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G069866 171 / 1e-54 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G070436 169 / 2e-54 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042752 150 / 6e-47 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
Lus10029722 156 / 1e-44 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10013729 149 / 1e-42 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10011104 148 / 9e-42 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10014582 137 / 4e-40 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2)
Lus10003749 142 / 1e-39 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10030345 141 / 2e-39 AT5G17680 528 / 5e-168 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10030839 141 / 3e-39 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10018616 140 / 3e-39 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10039850 139 / 9e-39 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF13676 TIR_2 TIR domain
Representative CDS sequence
>Potri.005G030413.5 pacid=42805545 polypeptide=Potri.005G030413.5.p locus=Potri.005G030413 ID=Potri.005G030413.5.v4.1 annot-version=v4.1
ATGGCTTCCTCTTCTTCTCCCACAACTCCATATTTGAAGCACGATGTGTTTCTCAGTTTTAGAGGCACAGACACCCGCAATGGTTTCACCAGTCATCTTT
ATGATGCTTTGCAGCGAAACCAAATTGATGCTTACATCGATAATAAACTTGATGGAGGAGAAACGATCGAGCCTGCCCTCTTGGAAAGGATTGAAGAGTC
GTTTATTTCGCTAGTCATTTTCTCTGAAAATTATGCAGATTCTACCTTCTGTTTGAGGGAACTCTCCAAGATTCTTGAGTGCATGGAGACCAAACAACAG
ATGGTCTTACCAGTATTTTACCGACTTGATCCAAGCCATGTTCAAAATCTGACTGGGAGCTATGGAGATGCACTTTGCAAGCATGAAAGAGATTGCAGTT
CTGAAGAAGTAGAGAGTTGGAGACGTGCTTTGAAAGAAATAGCTAATCTCAAGGGCTGGGATTCAGACGTCATTAAGTAA
AA sequence
>Potri.005G030413.5 pacid=42805545 polypeptide=Potri.005G030413.5.p locus=Potri.005G030413 ID=Potri.005G030413.5.v4.1 annot-version=v4.1
MASSSSPTTPYLKHDVFLSFRGTDTRNGFTSHLYDALQRNQIDAYIDNKLDGGETIEPALLERIEESFISLVIFSENYADSTFCLRELSKILECMETKQQ
MVLPVFYRLDPSHVQNLTGSYGDALCKHERDCSSEEVESWRRALKEIANLKGWDSDVIK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20142 Toll-Interleukin-Resistance (T... Potri.005G030413 0 1
AT1G69550 disease resistance protein (TI... Potri.005G030318 1.00 0.9824
AT1G69550 disease resistance protein (TI... Potri.005G031899 2.44 0.9697
AT1G69550 disease resistance protein (TI... Potri.005G030700 3.00 0.9513
AT5G17680 disease resistance protein (TI... Potri.005G031101 3.46 0.9428
AT2G20142 Toll-Interleukin-Resistance (T... Potri.005G032000 3.46 0.8951
AT5G27550 P-loop containing nucleoside t... Potri.005G031500 3.87 0.9335
Potri.017G003689 5.29 0.8917
AT3G28345 MDR13, ABCB15 multi-drug resistance 13, ATP-... Potri.018G087100 5.74 0.8633
AT5G36930 Disease resistance protein (TI... Potri.011G012000 6.70 0.8760
AT2G20142 Toll-Interleukin-Resistance (T... Potri.001G007501 6.92 0.8817

Potri.005G030413 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.