Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24130 59 / 7e-11 Leucine-rich receptor-like protein kinase family protein (.1) AT4G20140 55 / 1e-09 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1) AT3G49670 52 / 1e-08 BAM2 BARELY ANY MERISTEM 2, Leucine-rich receptor-like protein kinase family protein (.1) AT2G34930 51 / 3e-08 disease resistance family protein / LRR family protein (.1) AT5G65700 51 / 4e-08 BAM1 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2) AT5G21090 50 / 4e-08 Leucine-rich repeat (LRR) family protein (.1) AT5G63930 50 / 6e-08 Leucine-rich repeat protein kinase family protein (.1) AT1G17240 50 / 7e-08 AtRLP2 receptor like protein 2 (.1) AT3G43740 49 / 8e-08 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT5G62710 50 / 9e-08 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G031500 [exp] 150 / 2e-44 AT5G27550 378 / 7e-124 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.005G030800 [exp] 110 / 5e-29 AT3G47570 576 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G031300 [exp] 108 / 3e-28 AT3G47570 574 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G031700 [exp] 107 / 7e-28 AT5G20480 368 / 3e-113 EF-TU receptor (.1) Potri.013G020900 [exp] 103 / 1e-26 AT3G47570 593 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.012G028366 [exp] 60 / 3e-11 AT1G45616 316 / 5e-93 receptor like protein 6 (.1) Potri.012G009200 [exp] 59 / 4e-11 AT1G45616 386 / 7e-118 receptor like protein 6 (.1) Potri.006G237400 [exp] 59 / 6e-11 AT2G25790 885 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.001G042500 [exp] 58 / 1e-10 AT2G24130 703 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033104 [exp] 58 / 1e-10 AT5G62710 934 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10036672 [exp] 58 / 1e-10 AT5G62710 936 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10005017 [exp] 54 / 5e-09 AT4G08850 562 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2) Lus10019035 [exp] 54 / 5e-09 AT4G08850 861 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2) Lus10019036 [exp] 53 / 7e-09 AT4G08850 891 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2) Lus10012225 [exp] 53 / 8e-09 AT3G51740 679 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10006045 [exp] 53 / 8e-09 AT2G25790 858 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10006948 [exp] 53 / 9e-09 AT2G34930 637 / 0.0 disease resistance family protein / LRR family protein (.1) Lus10011609 [exp] 52 / 1e-08 AT2G25790 857 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10006945 [exp] 51 / 3e-08 AT2G34930 288 / 2e-90 disease resistance family protein / LRR family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF13855 [poplar] [flax] LRR_8 Leucine rich repeat
Representative CDS sequence Show only first row Show all	>Potri.005G030519.1 pacid=42803076 polypeptide=Potri.005G030519.1.p locus=Potri.005G030519 ID=Potri.005G030519.1.v4.1 annot-version=v4.1 ATGTATGTGTTGAAGAACCTTGAGATCCTTGACCTCCATAGCAACAACCTGGTCAGCAATTCTTCTCTCAGTTTTCTTATACTGAAGCTGTTGCAAAGAC TATATTTGGGGAGAAACAAGCTGCAAGGTTCCATTCCAGATGAAATGGGGCAGATGGAAAACCTTGGCTTACTTGATCTTGCCAATAATTCCATAACCGG GTCAATCCGATGTTCACTTGGTAACCTCTCACAGCTGAGATACCTTTACCTATCTTCAGCTTTCTTCTTAATGAAGCCTTTATCTTCAGCTTTCTTCCTA ATGAAGCCTTTATCTATCAAAATTGAACCGCCAAACTTGGCAACATTGTCCATGTTGATCCTCAAACCTCCGATTTGTTCAGTCTACCGTACGTTCTAA
AA sequence Show only first row Show all	>Potri.005G030519.1 pacid=42803076 polypeptide=Potri.005G030519.1.p locus=Potri.005G030519 ID=Potri.005G030519.1.v4.1 annot-version=v4.1 MYVLKNLEILDLHSNNLVSNSSLSFLILKLLQRLYLGRNKLQGSIPDEMGQMENLGLLDLANNSITGSIRCSLGNLSQLRYLYLSSAFFLMKPLSSAFFL MKPLSIKIEPPNLATLSMLILKPPICSVYRTF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G24130			Leucine-rich receptor-like pro...		Potri.005G030519 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Potri.003G150050 [exp]	1.41	0.9475
AT1G19180	ZIM	TIFY10A, JAZ1	jasmonate-zim-domain protein 1...		Potri.006G139400 [exp]	6.48	0.9366
AT3G17100	bHLH	bHLH147, AIF3	sequence-specific DNA binding ...		Potri.008G103500 [exp]	8.06	0.8596
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Potri.016G137400 [exp]	8.48	0.9190
AT1G19180	ZIM	TIFY10A, JAZ1	jasmonate-zim-domain protein 1...		Potri.001G166200 [exp]	8.71	0.9322
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Potri.003G081200 [exp]	8.83	0.9252
AT4G21865			unknown protein		Potri.008G172000 [exp]	11.61	0.9296
AT5G36930			Disease resistance protein (TI...		Potri.019G007884 [exp]	14.42	0.8938
AT1G32640	bHLH	JIN1, JAI1, ZBF...	JASMONATE INSENSITIVE 1, Basic...		Potri.001G142200 [exp]	14.69	0.9114	ATMYC2.2
AT3G05650		AtRLP32	receptor like protein 32 (.1)		Potri.012G008911 [exp]	14.83	0.8799

Compare expression of checked genes

Potri.005G030519 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.