Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47570 84 / 7e-20 Leucine-rich repeat protein kinase family protein (.1) AT3G47090 84 / 7e-20 Leucine-rich repeat protein kinase family protein (.1) AT5G39390 79 / 3e-18 Leucine-rich repeat protein kinase family protein (.1) AT3G47580 79 / 3e-18 Leucine-rich repeat protein kinase family protein (.1) AT3G47110 79 / 5e-18 Leucine-rich repeat protein kinase family protein (.1) AT2G24130 74 / 4e-16 Leucine-rich receptor-like protein kinase family protein (.1) AT5G20480 73 / 8e-16 EFR EF-TU receptor (.1) AT3G23750 72 / 8e-16 Leucine-rich repeat protein kinase family protein (.1) AT5G58940 68 / 3e-14 CRCK1 calmodulin-binding receptor-like cytoplasmic kinase 1 (.1) AT1G66150 68 / 4e-14 TMK1 transmembrane kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G030800 [exp] 210 / 3e-64 AT3G47570 576 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G031300 [exp] 209 / 5e-64 AT3G47570 574 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.013G020900 [exp] 187 / 7e-56 AT3G47570 593 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.016G114400 [exp] 94 / 2e-23 AT3G47570 600 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G103000 [exp] 90 / 8e-22 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G102900 [exp] 89 / 1e-21 AT3G47570 843 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G102800 [exp] 87 / 8e-21 AT3G47570 862 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G273001 [exp] 85 / 4e-20 AT3G47570 635 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.015G037400 [exp] 84 / 1e-19 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020140 [exp] 92 / 1e-22 AT3G47570 740 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10026938 [exp] 91 / 6e-22 AT5G20480 735 / 0.0 EF-TU receptor (.1) Lus10019525 [exp] 89 / 2e-21 AT3G47570 637 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10043368 [exp] 89 / 2e-21 AT3G47570 639 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10004827 [exp] 88 / 4e-21 AT3G47570 812 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10037310 [exp] 87 / 5e-21 AT3G47570 744 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10033362 [exp] 87 / 7e-21 AT3G47570 784 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10016896 [exp] 87 / 1e-20 AT3G47570 714 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10040184 [exp] 83 / 4e-20 AT3G47110 239 / 2e-72 Leucine-rich repeat protein kinase family protein (.1) Lus10033330 [exp] 84 / 7e-20 AT3G47570 783 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.005G030555.1 pacid=42804821 polypeptide=Potri.005G030555.1.p locus=Potri.005G030555 ID=Potri.005G030555.1.v4.1 annot-version=v4.1 ATGATGGGATCAATCTGGAATTCACAGTTCAAGGCTCTCATCCTTGAGTTTGTAGGAAATGGAAACTTGGAACAGCATCTTTATCCTGAGTCCGAGGGAG GAAACTGTCGATTGACGTTGAGTGAGAGATTAGGAATAGAAATAGATATTGCAAATGCCTTGGGAGTATCTTCAATCGGGTTGCTCAACTCAAGTGTTGT GCACTGTGATCTGAAACCACAAAATGTTCTTCTTGATGATTACATGGTGGCCCGTGTTGCGGACTTTGGAATTGGAAAGGTCTTTTTTGCTGCTAAACCA ACTGAATATTCTTCTACAGCAAGTGGCCTGCGAGGATCTGTTGGCTATATTCCTTCAGGTATGCATCTGTTCACTGGTTTGTGTTAG
AA sequence Show only first row Show all	>Potri.005G030555.1 pacid=42804821 polypeptide=Potri.005G030555.1.p locus=Potri.005G030555 ID=Potri.005G030555.1.v4.1 annot-version=v4.1 MMGSIWNSQFKALILEFVGNGNLEQHLYPESEGGNCRLTLSERLGIEIDIANALGVSSIGLLNSSVVHCDLKPQNVLLDDYMVARVADFGIGKVFFAAKP TEYSSTASGLRGSVGYIPSGMHLFTGLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47090			Leucine-rich repeat protein ki...		Potri.005G030555 [exp]	0	1
AT1G76900	TUB	AtTLP1	tubby like protein 1 (.1.2)		Potri.002G068200 [exp]	3.87	0.7776
AT1G07650			Leucine-rich repeat transmembr...		Potri.018G145536 [exp]	4.79	0.8077
					Potri.011G033200 [exp]	4.89	0.7702
					Potri.008G141600 [exp]	9.79	0.7293
AT5G07910			Leucine-rich repeat (LRR) fami...		Potri.015G048800 [exp]	12.36	0.7415
AT3G23000		PKS7, ATSRPK1, ...	SNF1-RELATED PROTEIN KINASE 3....		Potri.010G079000 [exp]	13.49	0.7440	CIPK4.2
AT1G77460			Armadillo/beta-catenin-like re...		Potri.002G081101 [exp]	15.16	0.7802
AT1G68760		ATNUDX1, ATNUDT...	NUDIX HYDROLASE 1, ARABIDOPSIS...		Potri.008G114400 [exp]	16.24	0.7230
AT3G19540			Protein of unknown function (D...		Potri.009G092400 [exp]	17.88	0.7623
AT3G26790	B3	FUS3	FUSCA 3, AP2/B3-like transcrip...		Potri.004G220300 [exp]	23.81	0.7631

Compare expression of checked genes

Potri.005G030555 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.