Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27550 228 / 9e-71 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G22610 178 / 6e-52 Di-glucose binding protein with Kinesin motor domain (.1.2) AT1G72250 174 / 2e-50 Di-glucose binding protein with Kinesin motor domain (.1.2) AT2G47500 135 / 6e-37 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT5G41310 128 / 1e-34 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT1G63640 128 / 2e-34 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) AT1G73860 125 / 2e-33 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G44730 122 / 1e-32 AtKIN14h, ATKP1 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) AT5G27000 121 / 3e-32 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) AT1G18410 114 / 9e-30 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G030271 [exp] 282 / 2e-91 AT5G27550 865 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.013G020700 [exp] 258 / 4e-82 AT5G27550 862 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.005G031500 [exp] 184 / 1e-56 AT5G27550 378 / 7e-124 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.011G140000 [exp] 174 / 2e-50 AT1G72250 1201 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Potri.001G436200 [exp] 173 / 3e-50 AT1G72250 1248 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Potri.002G110600 [exp] 171 / 1e-49 AT2G22610 1057 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Potri.014G125700 [exp] 137 / 1e-37 AT2G47500 1218 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.003G127800 [exp] 135 / 5e-37 AT1G63640 1065 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.001G467600 [exp] 133 / 3e-36 AT3G44730 1266 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029914 [exp] 214 / 3e-65 AT5G27550 905 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10004487 [exp] 211 / 2e-64 AT5G27550 881 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10035954 [exp] 180 / 1e-52 AT2G22610 1302 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10025708 [exp] 179 / 4e-52 AT2G22610 1238 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10005582 [exp] 164 / 5e-47 AT1G72250 1109 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10013714 [exp] 163 / 1e-46 AT1G72250 1098 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10032897 [exp] 131 / 2e-35 AT3G44730 1302 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Lus10032264 [exp] 130 / 3e-35 AT1G63640 991 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10024628 [exp] 127 / 4e-34 AT1G63640 980 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10009851 [exp] 124 / 5e-33 AT2G47500 1245 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00225 [poplar] [flax] Kinesin Kinesin motor domain
Representative CDS sequence Show only first row Show all	>Potri.005G031850.1 pacid=42802332 polypeptide=Potri.005G031850.1.p locus=Potri.005G031850 ID=Potri.005G031850.1.v4.1 annot-version=v4.1 ATGGACAAACTTGTGACATTGAATTTGAAGAAAGAACACTCAAATCTCTCTAATCAAGTAAAGACTGCCAAGGATTCCTTTCTTGGCCCCAATATTTTAG ACACCCTTCAAAAACTCGAGGCTGTTTTTGTACAAACTAAACCAATAGTTGCTTCAGTTTTGGATAGCTACAATGTCTGCATATTCACCTATGGACAAAC TGGAACTGGAAAGACATTTACTATGGAGGGCAGCCCAGAAAATAGGGGAGTGAACTACAGAACATTGGATGAGTTGTTCGGAGTTTCTCAAGAGAGAAGT GGCATTATGAGATATGGTCTTTTTGTTAGTATGACGGAGGTTTACAATGAGAAGATAAGGGACCTCTTGATTGATAGTTCCAACCAACCGCCTAAAAAGT TGGAGATAAAACAAACAGCTGAAGGAACACAAGAAGTCCCAGGACTTGTTGAAACTCGGGTGACTGGCACGGAGGATGTGTGGGATTTACTCAATTCTGG AAGTCGGGCCAGGTCTGTTGGATCAACCAGAGCTAATGAGCTTTAG
AA sequence Show only first row Show all	>Potri.005G031850.1 pacid=42802332 polypeptide=Potri.005G031850.1.p locus=Potri.005G031850 ID=Potri.005G031850.1.v4.1 annot-version=v4.1 MDKLVTLNLKKEHSNLSNQVKTAKDSFLGPNILDTLQKLEAVFVQTKPIVASVLDSYNVCIFTYGQTGTGKTFTMEGSPENRGVNYRTLDELFGVSQERS GIMRYGLFVSMTEVYNEKIRDLLIDSSNQPPKKLEIKQTAEGTQEVPGLVETRVTGTEDVWDLLNSGSRARSVGSTRANEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27550			P-loop containing nucleoside t...		Potri.005G031850 [exp]	0	1
AT5G27550			P-loop containing nucleoside t...		Potri.005G031500 [exp]	2.00	0.9179
					Potri.012G106675 [exp]	3.16	0.8569
AT1G69550			disease resistance protein (TI...		Potri.005G031899 [exp]	3.46	0.8948
AT5G40990		GLIP1	GDSL lipase 1 (.1)		Potri.017G136601 [exp]	3.46	0.8499
					Potri.017G021796 [exp]	4.24	0.8749
AT5G27550			P-loop containing nucleoside t...		Potri.005G031801 [exp]	9.16	0.8685
					Potri.017G019932 [exp]	10.95	0.8439
AT5G38460			ALG6, ALG8 glycosyltransferase...		Potri.017G114100 [exp]	11.40	0.7873
AT3G24600			Late embryogenesis abundant pr...		Potri.006G160100 [exp]	12.16	0.7435
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.005G030413 [exp]	12.84	0.8322

Compare expression of checked genes

Potri.005G031850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.