Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20142 127 / 9e-37 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G16990 127 / 6e-35 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT3G44480 124 / 8e-34 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G12010 124 / 1e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G65850 123 / 2e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G44630 122 / 4e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT3G44400 122 / 7e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 116 / 9e-33 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G16860 120 / 1e-32 RPP5, RPP4 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G04220 120 / 3e-32 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G030413 [exp] 263 / 4e-92 AT2G20142 132 / 5e-38 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.005G030700 [exp] 260 / 2e-81 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.005G030318 [exp] 260 / 3e-81 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.005G031101 [exp] 254 / 1e-79 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.004G088500 [exp] 233 / 9e-72 AT1G69550 647 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.005G062700 [exp] 167 / 3e-53 AT4G16990 149 / 1e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Potri.019G068200 [exp] 170 / 6e-50 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070436 [exp] 156 / 2e-49 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069866 [exp] 155 / 2e-48 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042752 [exp] 145 / 2e-45 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10029722 [exp] 149 / 2e-42 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 139 / 3e-39 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10003749 [exp] 136 / 6e-38 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10030839 [exp] 133 / 7e-37 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10011104 [exp] 132 / 3e-36 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 125 / 5e-36 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10039850 [exp] 130 / 6e-36 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005588 [exp] 130 / 9e-36 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026201 [exp] 129 / 3e-35 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.005G032000.1 pacid=42804373 polypeptide=Potri.005G032000.1.p locus=Potri.005G032000 ID=Potri.005G032000.1.v4.1 annot-version=v4.1 ATGAAGCACGATGTATTCATCAGTTTTAGAGGCACAGACACCCGCTATAGTTTTACCAGTCATCTTTATGATGCTTTGCAGCGAAAACAAATTGATGCTT ACATCGATGATAAACTTGATGGAGGAGAAAAGATCGAGCCTGCCATCTTGGAAGGGATTGAAGAGTCGTTTATTTCGGTAGTCATTTTCTCTGAAAATTA TGCAGATTCTACTTTCTGTTTAAGAGAACTCTCCAAGATTCTCGAGTGCATGGAGACCAAACAACAGATGGTTTTACCAGTTTTTTACCGACTTGATCCA TGCCAAGTTCAAAACCTGACTGGGAGCTATGGAGATGCACTTTGCAAGCATGAAAAAGATTGTGGTTCTAAAGAAGTAGAGAGTTGGAGACATGCTTTGA AAGAAATAGCTAATCTCAAGCACTACTAA
AA sequence Show only first row Show all	>Potri.005G032000.1 pacid=42804373 polypeptide=Potri.005G032000.1.p locus=Potri.005G032000 ID=Potri.005G032000.1.v4.1 annot-version=v4.1 MKHDVFISFRGTDTRYSFTSHLYDALQRKQIDAYIDDKLDGGEKIEPAILEGIEESFISVVIFSENYADSTFCLRELSKILECMETKQQMVLPVFYRLDP CQVQNLTGSYGDALCKHEKDCGSKEVESWRHALKEIANLKHY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.005G032000 [exp]	0	1
AT1G69550			disease resistance protein (TI...		Potri.005G030318 [exp]	2.64	0.9064
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.005G030413 [exp]	3.46	0.8951
AT1G69550			disease resistance protein (TI...		Potri.005G031899 [exp]	4.58	0.8774
AT5G36930			Disease resistance protein (TI...		Potri.011G012000 [exp]	4.89	0.8709
AT4G27290			S-locus lectin protein kinase ...		Potri.001G412000 [exp]	7.74	0.8479
AT5G27550			P-loop containing nucleoside t...		Potri.005G031500 [exp]	8.77	0.8417
AT5G17680			disease resistance protein (TI...		Potri.019G069600 [exp]	12.12	0.8075
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.001G007501 [exp]	12.84	0.8259
AT5G17680			disease resistance protein (TI...		Potri.005G031101 [exp]	19.44	0.8333
AT1G23870		ATTPS9	TREHALOSE -6-PHOSPHATASE SYNTH...		Potri.015G074000 [exp]	20.97	0.7907	Pt-TPS8.2

Compare expression of checked genes

Potri.005G032000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.