Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55020 65 / 2e-13 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) AT3G22400 59 / 1e-11 ATLOX5, LOX5 Arabidopsis thaliana lipoxygenase 5, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G032600 [exp] 132 / 5e-37 AT1G55020 1284 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Potri.005G032800 [exp] 130 / 1e-36 AT1G55020 1240 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Potri.013G022100 [exp] 96 / 1e-24 AT1G55020 1241 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Potri.013G022000 [exp] 86 / 6e-21 AT1G55020 1311 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Potri.005G032400 [exp] 85 / 1e-20 AT1G55020 1308 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Potri.005G032700 [exp] 82 / 2e-19 AT1G55020 1307 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Potri.008G151500 [exp] 76 / 2e-17 AT3G22400 1274 / 0.0 Arabidopsis thaliana lipoxygenase 5, PLAT/LH2 domain-containing lipoxygenase family protein (.1) Potri.010G089500 [exp] 73 / 2e-16 AT3G22400 1267 / 0.0 Arabidopsis thaliana lipoxygenase 5, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015184 [exp] 71 / 2e-15 AT1G55020 1245 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Lus10031505 [exp] 71 / 2e-15 AT1G55020 1237 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Lus10008202 [exp] 63 / 1e-12 AT1G55020 1100 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1) Lus10004915 [exp] 61 / 6e-12 AT3G22400 1289 / 0.0 Arabidopsis thaliana lipoxygenase 5, PLAT/LH2 domain-containing lipoxygenase family protein (.1) Lus10001465 [exp] 53 / 3e-09 AT1G55020 1162 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G032650.1 pacid=42804298 polypeptide=Potri.005G032650.1.p locus=Potri.005G032650 ID=Potri.005G032650.1.v4.1 annot-version=v4.1 ATGTTTCAGAACATTGTTACTGCTATCGCATCATGCTGTGCAGGGGACAGTAAGATGAAGATCAAAGGCACTGTTGTGTTGATGAAGAAGAATGTCTTAG AATTCAATGACTTTCCTGCTTCGGTTCTTGATCGTGGCCATGAGTTGTTAGGCCAAGGAGTCTCTCTGCAAGTCATTAGCGCTGCTAAAAGTGACCCTCC AGGTATATATACAACAGTTCTTTCATCATTTTGTTGCTGGTTCAGTGCTTCATGCATGCCTTTTCAATCCCATGATGTTTTTCTTTTGTTGCTCGATGAA GTTCATTAA
AA sequence Show only first row Show all	>Potri.005G032650.1 pacid=42804298 polypeptide=Potri.005G032650.1.p locus=Potri.005G032650 ID=Potri.005G032650.1.v4.1 annot-version=v4.1 MFQNIVTAIASCCAGDSKMKIKGTVVLMKKNVLEFNDFPASVLDRGHELLGQGVSLQVISAAKSDPPGIYTTVLSSFCCWFSASCMPFQSHDVFLLLLDE VH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.005G032650 [exp]	0	1
AT4G31980			unknown protein		Potri.003G207750 [exp]	21.35	0.8957
AT2G15620		ATHNIR, NIR1	ARABIDOPSIS THALIANA NITRITE R...		Potri.009G101600 [exp]	24.37	0.9227
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.008G034200 [exp]	25.27	0.9144
AT4G31980			unknown protein		Potri.003G206101 [exp]	26.83	0.9079
AT5G63520			unknown protein		Potri.012G100600 [exp]	32.86	0.9211
AT4G31980			unknown protein		Potri.003G206201 [exp]	33.91	0.9202
AT2G21210			SAUR-like auxin-responsive pro...		Potri.009G127500 [exp]	35.09	0.9026
AT5G35390			Leucine-rich repeat protein ki...		Potri.006G078600 [exp]	36.49	0.9182
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.001G469000 [exp]	37.96	0.9123
AT1G42540		ATGLR3.3	glutamate receptor 3.3 (.1)		Potri.005G253800 [exp]	64.14	0.8834	Pt-GLR3.4

Compare expression of checked genes

Potri.005G032650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.