Potri.005G033600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05327 184 / 7e-59 Cyclin family protein (.1)
AT3G63120 153 / 8e-47 CYCP1;1 cyclin p1;1 (.1)
AT5G07450 150 / 2e-45 CYCP4;3 cyclin p4;3 (.1)
AT2G44740 149 / 4e-45 CYCP4;1 cyclin p4;1 (.1)
AT5G61650 142 / 3e-42 CYCP4;2 CYCLIN P4;2 (.1)
AT3G21870 141 / 3e-42 CYCP2;1 cyclin p2;1 (.1)
AT3G60550 129 / 3e-37 CYCP3;2 cyclin p3;2 (.1)
AT2G45080 127 / 1e-36 CYCP3;1 cyclin p3;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G023000 337 / 1e-119 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.002G052800 226 / 4e-75 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.005G209800 222 / 1e-73 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.007G121500 159 / 7e-49 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.014G050400 155 / 6e-48 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.015G112140 154 / 2e-47 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.012G114600 150 / 1e-45 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.002G143400 141 / 4e-42 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.014G066400 137 / 2e-40 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042582 207 / 6e-68 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10022038 207 / 1e-67 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10004475 199 / 6e-65 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10029933 199 / 1e-64 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10039697 145 / 1e-43 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10027148 145 / 1e-42 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10032505 142 / 4e-42 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 142 / 6e-42 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10042873 137 / 2e-40 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 126 / 2e-36 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.005G033600.4 pacid=42802469 polypeptide=Potri.005G033600.4.p locus=Potri.005G033600 ID=Potri.005G033600.4.v4.1 annot-version=v4.1
ATGGCAAATTTGGTGCTCAATGGCATGGCTGCTGAATCAGAAACTTGCATGGCTTTGGGTTTATTAGATGAATCCAGTAGAGGGGCTTCAGGAACTCCAC
AGGTATTGCTGCTTATTGCATCTGTTTTAGAGAGATCCATTCAAAAGAACGAAGAGCTGTCAAACACAGCTAGAAAAGATGTTATTACAATCTTCCATGG
ATCAAGATCACCCACCTTGAGCATTAAGCAGTATATCGAACGCATATTCAAGTACTCAGGATGCAGCAGTTCTTGCCTTGTTGTTGCTTACATATACATC
AACAAGTTCCTTCAACTAACGGATGGCCATCTTACTTCCCTAAACGCACACCGTCTTCTGATTACAAGCATCATGGTAGCTGCAAAATTTTTGGATGATG
AGTGTTACGACAATGCCTATTATGCCAGGATTGGAGGTGTAAGCACCGGAGAAATGAATAGAATGGAGATGAGATTCTTGTTCAATTTGGATTTCAGGCT
CCAGGTTACAGTCGAAGCATTCATGAACTGCTGCTTGAAACTAGAAAATGAAAGTGGCAGGTACGAGGATGGACAGGCTGATCCAAGCCTGTGGGTTCAA
AGGCCGGCAAAACAAAGATGA
AA sequence
>Potri.005G033600.4 pacid=42802469 polypeptide=Potri.005G033600.4.p locus=Potri.005G033600 ID=Potri.005G033600.4.v4.1 annot-version=v4.1
MANLVLNGMAAESETCMALGLLDESSRGASGTPQVLLLIASVLERSIQKNEELSNTARKDVITIFHGSRSPTLSIKQYIERIFKYSGCSSSCLVVAYIYI
NKFLQLTDGHLTSLNAHRLLITSIMVAAKFLDDECYDNAYYARIGGVSTGEMNRMEMRFLFNLDFRLQVTVEAFMNCCLKLENESGRYEDGQADPSLWVQ
RPAKQR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05327 Cyclin family protein (.1) Potri.005G033600 0 1
AT4G10030 alpha/beta-Hydrolases superfam... Potri.019G074600 1.00 0.9761
AT4G10150 RING/U-box superfamily protein... Potri.014G076800 2.44 0.9550
Potri.005G084651 4.00 0.9701
AT2G46550 unknown protein Potri.005G071400 5.09 0.9449
AT1G20970 unknown protein Potri.016G047500 5.29 0.9432
AT4G34090 unknown protein Potri.007G045900 6.92 0.9589
AT4G27745 Yippee family putative zinc-bi... Potri.015G009200 7.34 0.9267
AT4G32330 TPX2 (targeting protein for Xk... Potri.006G254400 7.87 0.9129
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Potri.006G052700 8.94 0.9369
AT2G20740 Tetraspanin family protein (.1... Potri.019G101800 9.79 0.8938

Potri.005G033600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.