Potri.005G034300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54860 99 / 6e-26 Glycoprotein membrane precursor GPI-anchored (.1)
AT3G06035 85 / 2e-20 Glycoprotein membrane precursor GPI-anchored (.1)
AT5G19250 79 / 2e-18 Glycoprotein membrane precursor GPI-anchored (.1)
AT5G19230 67 / 8e-14 Glycoprotein membrane precursor GPI-anchored (.1)
AT5G19240 59 / 5e-11 Glycoprotein membrane precursor GPI-anchored (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G034200 240 / 2e-81 AT1G54860 110 / 2e-30 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.005G034400 135 / 3e-40 AT1G54860 167 / 6e-53 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.008G195000 100 / 1e-26 AT3G06035 231 / 2e-77 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.013G023801 93 / 2e-24 AT1G54860 102 / 4e-28 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.010G033400 87 / 2e-21 AT3G06035 214 / 4e-71 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.013G023701 79 / 6e-19 AT1G54860 62 / 8e-13 Glycoprotein membrane precursor GPI-anchored (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004470 110 / 1e-30 AT1G54860 190 / 2e-61 Glycoprotein membrane precursor GPI-anchored (.1)
Lus10029938 108 / 3e-27 AT1G08960 640 / 0.0 cation calcium exchanger 5, Arabidopsis thaliana cation calcium exchanger 5, cation exchanger 11 (.1)
Lus10034054 83 / 1e-19 AT3G06035 220 / 2e-73 Glycoprotein membrane precursor GPI-anchored (.1)
Lus10010516 77 / 1e-17 AT3G06035 226 / 9e-76 Glycoprotein membrane precursor GPI-anchored (.1)
PFAM info
Representative CDS sequence
>Potri.005G034300.1 pacid=42803345 polypeptide=Potri.005G034300.1.p locus=Potri.005G034300 ID=Potri.005G034300.1.v4.1 annot-version=v4.1
ATGGCCTCTCTCAAAGTTAACATCTGTCTCTTTGTGCTTTTTCATGCCATTTTCTTGCTTTCTTCTGAAGTATTGGGCTATGGCGGTGACGAACTCAAGC
TTTTGGAGAACATCAATACTTACAGGACATCATACTGGGACATACCGGCCCTGACCAAGAATAAGAAGGCAAGATGCGTCGCAAAAAACATTGCTGCCAC
GCTAGAGCAACCTTGTAATGAAACCACTCGTCCTTTCAAGGTTATACTAGATAAGTACCCAGATCAATTAGCTAACTGCATTGGCACTAACCATACCACA
GATGGTGTAGTATTGCCGGTTTGCTTGCCTGAGGATGGTCTAGCTGAAGTTTCATTGCTTCATAATTATACTCGAACTCGGTATGTAAATTACATAAAAG
ACTCGAATTTTACCGGGATAGGAATTGGATCCAATGATTATTGGATGGTGGTTGTTCTGAACAAAAAAACCTCAACATGGAGTAGTTCTGCAAGCGCAAA
TGGTTTGGTTTCAAAGCTTGGTTTTGGTCATGGAGTCGTGTCTTTGTTTCTGGGGATGCTCTTTTATCTGGTGTTATGA
AA sequence
>Potri.005G034300.1 pacid=42803345 polypeptide=Potri.005G034300.1.p locus=Potri.005G034300 ID=Potri.005G034300.1.v4.1 annot-version=v4.1
MASLKVNICLFVLFHAIFLLSSEVLGYGGDELKLLENINTYRTSYWDIPALTKNKKARCVAKNIAATLEQPCNETTRPFKVILDKYPDQLANCIGTNHTT
DGVVLPVCLPEDGLAEVSLLHNYTRTRYVNYIKDSNFTGIGIGSNDYWMVVVLNKKTSTWSSSASANGLVSKLGFGHGVVSLFLGMLFYLVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G54860 Glycoprotein membrane precurso... Potri.005G034300 0 1
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Potri.011G135400 1.00 0.9964
AT5G18970 AWPM-19-like family protein (.... Potri.008G200300 1.41 0.9935
AT3G17380 TRAF-like family protein (.1) Potri.008G005300 1.73 0.9920
AT3G50120 Plant protein of unknown funct... Potri.001G071400 2.00 0.9901
AT5G22870 Late embryogenesis abundant (L... Potri.009G003800 2.23 0.9900
AT5G41470 Nuclear transport factor 2 (NT... Potri.001G100500 3.46 0.9897
AT3G17730 NAC ANAC057 NAC domain containing protein ... Potri.012G038100 3.74 0.9888 NAC020
AT1G54400 HSP20-like chaperones superfam... Potri.013G054700 5.19 0.9834
AT3G61172 LCR8 low-molecular-weight cysteine-... Potri.016G061300 5.47 0.9800
AT1G47271 Cystathionine beta-synthase (C... Potri.005G228300 5.74 0.9817

Potri.005G034300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.