Potri.005G036500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16710 253 / 3e-87 glycosyltransferase family protein 28 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G025600 332 / 3e-118 AT4G16710 247 / 1e-84 glycosyltransferase family protein 28 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018891 283 / 1e-98 AT4G16710 258 / 5e-89 glycosyltransferase family protein 28 (.1.2)
Lus10028587 281 / 3e-98 AT4G16710 263 / 5e-91 glycosyltransferase family protein 28 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF13528 Glyco_trans_1_3 Glycosyl transferase family 1
Representative CDS sequence
>Potri.005G036500.1 pacid=42802396 polypeptide=Potri.005G036500.1.p locus=Potri.005G036500 ID=Potri.005G036500.1.v4.1 annot-version=v4.1
ATGGGAGATATTGAGGAGAGTGTGAAGCAAGAGAAGAAAGTGGTATTTGTAACTGTAGGAACAACATTGTTTGATGCTCTTGTGAGAACTGTGGATACTA
AGGAAGTTAAACAAGAGTTATTAAGAAACGGATATACCCACCTCATTATTCAAATGGGTCGAGGATCTTACACTCCTGCCAAGAGTGAAGGAAAAGATGG
ATCTCTGGCTGTTGATTACTTCACTTTTTCACCAAGCATTGCAGACCATCTGAGATCAGCATCTCTTGTCATCAGCCATGCAGGGTCAGGGAGCATATTT
GAAACTTTGCAGCTTGGTAAACCTCTAATTGTTGTGGTTAATGAAGATTTGATGGACAATCATCAAAGTGAACTTGCAGAAGAACTAGCAGAGAGGAAGC
ATTTATACTGTGCTCATCCTCAAACGCTTCATCAGACAATATCTGATATGAATATTGAGTCCCTCCTTCCATACCCGCCAGGTGATGCCGCAGCAGTCGC
CAAGCTGATAAACAGGTTTCTAGGTTTCCCAGATGATTGA
AA sequence
>Potri.005G036500.1 pacid=42802396 polypeptide=Potri.005G036500.1.p locus=Potri.005G036500 ID=Potri.005G036500.1.v4.1 annot-version=v4.1
MGDIEESVKQEKKVVFVTVGTTLFDALVRTVDTKEVKQELLRNGYTHLIIQMGRGSYTPAKSEGKDGSLAVDYFTFSPSIADHLRSASLVISHAGSGSIF
ETLQLGKPLIVVVNEDLMDNHQSELAEELAERKHLYCAHPQTLHQTISDMNIESLLPYPPGDAAAVAKLINRFLGFPDD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16710 glycosyltransferase family pro... Potri.005G036500 0 1
AT2G44525 Protein of unknown function (D... Potri.014G179500 5.47 0.7559
AT4G18800 AthSGBP, AtRab1... RAB GTPase homolog A1D (.1) Potri.004G061000 6.48 0.7316
AT1G71990 ATFT4, ATFUT13,... ARABIDOPSIS FUCOSYLTRANSFERASE... Potri.019G082200 7.61 0.5902
AT5G61310 Cytochrome c oxidase subunit V... Potri.014G120500 13.85 0.7103
AT5G25940 early nodulin-related (.1) Potri.019G033700 25.13 0.6755
AT1G64355 unknown protein Potri.001G093001 25.27 0.6553
AT4G23760 Cox19-like CHCH family protein... Potri.003G136500 27.49 0.6359
AT3G13674 unknown protein Potri.018G082800 31.93 0.6737
AT1G80500 SNARE-like superfamily protein... Potri.003G183400 36.74 0.6660
AT3G24570 Peroxisomal membrane 22 kDa (M... Potri.018G081600 41.74 0.6587

Potri.005G036500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.