Potri.005G037300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08930 143 / 2e-41 ERD6 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
AT1G08920 142 / 3e-41 ESL1 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
AT1G08900 141 / 5e-41 Major facilitator superfamily protein (.1.2.3)
AT5G27350 139 / 9e-40 SFP1 Major facilitator superfamily protein (.1)
AT3G05165 137 / 3e-39 Major facilitator superfamily protein (.1.2.3.4.5)
AT5G27360 134 / 3e-38 SFP2 Major facilitator superfamily protein (.1)
AT3G05160 133 / 3e-38 Major facilitator superfamily protein (.1.2)
AT1G54730 133 / 9e-38 Major facilitator superfamily protein (.1.2.3)
AT5G18840 132 / 3e-37 Major facilitator superfamily protein (.1)
AT1G08890 132 / 3e-37 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G037000 248 / 1e-81 AT1G08920 483 / 3e-168 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Potri.013G027700 210 / 4e-67 AT1G08930 483 / 6e-168 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Potri.005G039900 179 / 6e-55 AT1G08920 461 / 1e-159 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Potri.013G027800 166 / 4e-50 AT5G27360 405 / 6e-138 Major facilitator superfamily protein (.1)
Potri.013G027500 147 / 4e-43 AT1G54730 606 / 0.0 Major facilitator superfamily protein (.1.2.3)
Potri.010G026500 137 / 3e-39 AT5G18840 686 / 0.0 Major facilitator superfamily protein (.1)
Potri.005G040000 129 / 5e-36 AT1G54730 429 / 2e-147 Major facilitator superfamily protein (.1.2.3)
Potri.002G212900 122 / 1e-33 AT2G48020 723 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.014G136600 117 / 6e-32 AT2G48020 665 / 0.0 Major facilitator superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033812 155 / 6e-46 AT1G08930 499 / 1e-174 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Lus10033814 151 / 2e-44 AT1G08920 466 / 8e-162 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Lus10029960 149 / 2e-43 AT1G54730 490 / 3e-170 Major facilitator superfamily protein (.1.2.3)
Lus10029962 143 / 3e-41 AT1G54730 451 / 2e-155 Major facilitator superfamily protein (.1.2.3)
Lus10029961 140 / 2e-39 AT1G54730 429 / 3e-144 Major facilitator superfamily protein (.1.2.3)
Lus10035354 137 / 4e-39 AT1G54730 615 / 0.0 Major facilitator superfamily protein (.1.2.3)
Lus10029971 132 / 4e-38 AT1G54730 211 / 1e-64 Major facilitator superfamily protein (.1.2.3)
Lus10012780 132 / 3e-37 AT5G18840 685 / 0.0 Major facilitator superfamily protein (.1)
Lus10035355 129 / 4e-37 AT5G27350 253 / 1e-80 Major facilitator superfamily protein (.1)
Lus10029964 129 / 8e-36 AT1G54730 419 / 2e-142 Major facilitator superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Potri.005G037300.2 pacid=42805160 polypeptide=Potri.005G037300.2.p locus=Potri.005G037300 ID=Potri.005G037300.2.v4.1 annot-version=v4.1
ATGCAAAACAGTGCAATCCACAGTAAAAGCACTATAATAAGTTCATACTTGAAAGAGCTCACCCCAATATTGACTTTGGTTGGCATATTGGGTTTCGGCT
GCGGTTTTGCCATAGGCATGTCAGGAATACCTTGGGTTATAATGGCAGAGATATATCCTGTAAATGTTAAGGCATCAGCAGGAAGCCTAGTGGTTTTAAC
CAGCTGGGCTAGTTCTTGGGTTGTGACATACACATTTAATTTTATGCTGGAGTGGAGTTCAGCTGGGACATTCTTCATCTTCAGTGGAATGTGTGCTTTA
ACTATTTTATTCGTATGGAAGTTGGTGCCAGAGACGAAGGGAAGAACATTAGAAGAAATACAATCAAGATTAATCACTCAGATCCCTGGACAAAACTCGG
TGATAGCGAAAACATAA
AA sequence
>Potri.005G037300.2 pacid=42805160 polypeptide=Potri.005G037300.2.p locus=Potri.005G037300 ID=Potri.005G037300.2.v4.1 annot-version=v4.1
MQNSAIHSKSTIISSYLKELTPILTLVGILGFGCGFAIGMSGIPWVIMAEIYPVNVKASAGSLVVLTSWASSWVVTYTFNFMLEWSSAGTFFIFSGMCAL
TILFVWKLVPETKGRTLEEIQSRLITQIPGQNSVIAKT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G08930 ERD6 EARLY RESPONSE TO DEHYDRATION ... Potri.005G037300 0 1
AT1G16445 S-adenosyl-L-methionine-depend... Potri.007G069400 20.78 0.7893
Potri.018G110525 21.67 0.8227
AT4G32480 Protein of unknown function (D... Potri.013G129900 23.06 0.8220
Potri.005G123600 26.49 0.8221
AT4G22790 MATE efflux family protein (.1... Potri.001G115400 27.87 0.7796
Potri.003G137900 30.39 0.8092
Potri.001G174000 30.46 0.8220
Potri.003G152701 30.59 0.8067
AT1G13560 AAPT1, ATAAPT1 aminoalcoholphosphotransferase... Potri.008G109833 31.49 0.7664
AT4G14385 unknown protein Potri.005G223900 37.14 0.7515

Potri.005G037300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.