Potri.005G037850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G037850.1 pacid=42804172 polypeptide=Potri.005G037850.1.p locus=Potri.005G037850 ID=Potri.005G037850.1.v4.1 annot-version=v4.1
ATGGAAACATCTTCTTCTCCACGAAGCAAGAAATCTTCCTTCACTGCCGGTGATGAGCCGAAGGAAGATGAGAACGACATGATCAAGTCATCATGCCCCT
TATGCCCTAGGCGACCCACATGCTACAATGGTCAGGATAAAGGGTCGCGATCCCGTGAGCGTGAGCTAACTCCAAAAACCTGTCCTTGGTTCGGATTGCA
GGCTGCAACTCGCTGA
AA sequence
>Potri.005G037850.1 pacid=42804172 polypeptide=Potri.005G037850.1.p locus=Potri.005G037850 ID=Potri.005G037850.1.v4.1 annot-version=v4.1
METSSSPRSKKSSFTAGDEPKEDENDMIKSSCPLCPRRPTCYNGQDKGSRSRERELTPKTCPWFGLQAATR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G037850 0 1
AT1G61330 FBD, F-box and Leucine Rich Re... Potri.004G034500 10.24 0.8154
Potri.006G228650 17.94 0.7754
Potri.012G134051 20.34 0.7754
AT1G78720 SecY protein transport family ... Potri.011G114900 29.56 0.7754
AT5G15948 CPuORF10 conserved peptide upstream ope... Potri.017G108901 30.33 0.7754
AT5G12460 Protein of unknown function (D... Potri.001G256200 31.08 0.7754
Potri.003G054301 31.81 0.7754
Potri.011G074033 32.52 0.7753
AT4G38470 STY46 serine/threonine/tyrosine kina... Potri.004G179457 38.17 0.7114
Potri.014G065100 38.88 0.6713

Potri.005G037850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.