Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54790 66 / 7e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) AT3G26430 60 / 9e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G67830 60 / 1e-11 ATFXG1 Arabidopsis thaliana alpha-fucosidase 1, alpha-fucosidase 1 (.1) AT3G27950 54 / 8e-10 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G56670 54 / 8e-10 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G09390 54 / 9e-10 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G05180 54 / 1e-09 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT4G01130 52 / 5e-09 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G14450 50 / 2e-08 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G31550 45 / 1e-06 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G216000 [exp] 72 / 3e-16 AT1G54790 474 / 1e-167 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.005G038800 [exp] 69 / 4e-15 AT1G54790 595 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.013G026300 [exp] 69 / 6e-15 AT1G54790 605 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.010G047900 [exp] 62 / 1e-12 AT3G26430 504 / 1e-179 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G074400 [exp] 61 / 3e-12 AT3G26430 388 / 8e-134 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G177900 [exp] 59 / 9e-12 AT3G26430 154 / 2e-45 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.002G083700 [exp] 57 / 1e-10 AT3G26430 417 / 3e-145 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.008G185500 [exp] 56 / 2e-10 AT3G26430 534 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G177700 [exp] 56 / 3e-10 AT3G26430 407 / 2e-141 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029981 [exp] 69 / 2e-16 AT1G54790 92 / 3e-23 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029980 [exp] 72 / 8e-16 AT1G54790 578 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029638 [exp] 70 / 3e-15 AT1G54790 443 / 2e-155 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029639 [exp] 68 / 2e-14 AT1G54790 421 / 4e-147 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10008784 [exp] 58 / 4e-11 AT3G27950 391 / 2e-135 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10006224 [exp] 55 / 6e-10 AT3G26430 342 / 5e-111 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10022233 [exp] 53 / 3e-09 AT3G27950 280 / 4e-92 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10014592 [exp] 52 / 7e-09 AT5G14450 573 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10032094 [exp] 52 / 7e-09 AT5G14450 578 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10001522 [exp] 52 / 8e-09 AT1G09390 459 / 3e-162 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G038850.1 pacid=42802866 polypeptide=Potri.005G038850.1.p locus=Potri.005G038850 ID=Potri.005G038850.1.v4.1 annot-version=v4.1 ATGGCTGACAGAGACATTGCTCTGCAAATTCTCACCCTATTATCCATCCTATCATCCACTGTAAACTCAATTGATTTCAATTACCCTGCAGTTTTCAATT TTGGTGATTCAAACTCTGACACAGGTGAACTTGCTGCTGGCCTAGGCTTCCTACTTGCCCCACCTAACGGACAAATTTACTTCAAAACTCCCACAGGAAG GTTCTGTGATGGCCGTCTCAATGTTGATTTTCTAAGTAAAGTTTCTATCTCTAACCTTGCCAAACTTTGCCACTTTTATTGCATGCAAAATGATTTTGTA TACACTTTACAATAG
AA sequence Show only first row Show all	>Potri.005G038850.1 pacid=42802866 polypeptide=Potri.005G038850.1.p locus=Potri.005G038850 ID=Potri.005G038850.1.v4.1 annot-version=v4.1 MADRDIALQILTLLSILSSTVNSIDFNYPAVFNFGDSNSDTGELAAGLGFLLAPPNGQIYFKTPTGRFCDGRLNVDFLSKVSISNLAKLCHFYCMQNDFV YTLQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54790			GDSL-like Lipase/Acylhydrolase...		Potri.005G038850 [exp]	0	1
AT1G66120			AMP-dependent synthetase and l...		Potri.006G036300 [exp]	8.24	0.7636
AT1G71010		FAB1C	FORMS APLOID AND BINUCLEATE CE...		Potri.008G128800 [exp]	9.00	0.7669
AT3G61590		HWS, HS	HAWAIIAN SKIRT, Galactose oxid...		Potri.002G166500 [exp]	10.09	0.6677
AT1G27850			unknown protein		Potri.008G178600 [exp]	12.48	0.7729
AT5G55970			RING/U-box superfamily protein...		Potri.011G094800 [exp]	12.60	0.7810
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Potri.007G080300 [exp]	13.67	0.7316
AT1G76140			Prolyl oligopeptidase family p...		Potri.002G014000 [exp]	21.16	0.7258
AT2G16980			Major facilitator superfamily ...		Potri.008G022100 [exp]	24.37	0.6659
AT1G29170		ATSCAR3, WAVE2	WASP \(WISKOTT-ALDRICH SYNDROM...		Potri.011G066100 [exp]	29.08	0.7540
AT1G80280			alpha/beta-Hydrolases superfam...		Potri.001G174900 [exp]	30.16	0.7522

Compare expression of checked genes

Potri.005G038850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.