Potri.005G043600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G030800 81 / 8e-18 AT2G19210 224 / 2e-63 Leucine-rich repeat transmembrane protein kinase protein (.1)
Potri.005G043700 79 / 2e-17 AT3G46280 216 / 3e-63 protein kinase-related (.1)
Potri.013G030100 48 / 1e-06 AT1G05700 207 / 3e-58 Leucine-rich repeat transmembrane protein kinase protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G043600.1 pacid=42803529 polypeptide=Potri.005G043600.1.p locus=Potri.005G043600 ID=Potri.005G043600.1.v4.1 annot-version=v4.1
ATGGCTAGTTGCCTGGTGTTACTCGTCCTGGCTTTCTTCGTTTTCTCAACAAATGTAGATGCACAAGTTACCGTTTATTGTCAAGCATCCGATTACAACA
ATGAAGTATTGATGCAATGGATGTATGCCAACGGCATATCCTGTCAGCCAATTACTAGCAGCACCACAAGTACTCCTTCAATTAGCAGCAAAAGCATTGA
AGTTGATTGTGAAGGATCCAGATTTTACGTGGATGAAAATGTTTTAGAATGGATATATGCCAACAACATACCCTGTCATCCAATTACTAGAAGCAAAAAG
AGAAACAAGCTTCCCATTATACTTGGAACCGTCATTCCAATTTTCTGCCTTTTCTGGGCTATTGTGGGGTTTATAGTGCACCACAAGAGAAAAACAGCAG
CCATTGCTGCAATAACTACAGGACAAGTTGACGGTGCCAATAAGCATACTCAGGGATCACTAAGTGCCGATGGGATCAAGATCAACATCCACGACCAAAC
AAGTCAAGGGATTGGTGATGAATATCCACGGCAGCAACAGGAAAGCAACCATGCCTGA
AA sequence
>Potri.005G043600.1 pacid=42803529 polypeptide=Potri.005G043600.1.p locus=Potri.005G043600 ID=Potri.005G043600.1.v4.1 annot-version=v4.1
MASCLVLLVLAFFVFSTNVDAQVTVYCQASDYNNEVLMQWMYANGISCQPITSSTTSTPSISSKSIEVDCEGSRFYVDENVLEWIYANNIPCHPITRSKK
RNKLPIILGTVIPIFCLFWAIVGFIVHHKRKTAAIAAITTGQVDGANKHTQGSLSADGIKINIHDQTSQGIGDEYPRQQQESNHA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G043600 0 1
AT4G01580 B3 AP2/B3-like transcriptional fa... Potri.007G035700 5.83 0.6580
AT3G54170 ATFIP37 FKBP12 interacting protein 37 ... Potri.002G197600 8.12 0.5797 ATFIP37.1
AT1G57775 Protein of unknown function (D... Potri.004G115100 8.66 0.6204
AT2G33205 Serinc-domain containing serin... Potri.003G174200 11.44 0.6778
AT1G32120 unknown protein Potri.001G132800 26.98 0.5898
AT5G58170 GDPDL7, SVL5 Glycerophosphodiester phosphod... Potri.006G187600 27.91 0.5845
AT1G20480 AMP-dependent synthetase and l... Potri.003G210600 30.19 0.5684
AT2G06925 ATSPLA2-ALPHA, ... PHOSPHOLIPASE A2-ALPHA, Phosph... Potri.006G070400 36.98 0.5552
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.005G007200 38.30 0.6112 EXT.9
AT1G20480 AMP-dependent synthetase and l... Potri.003G210701 40.09 0.5988

Potri.005G043600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.