Plant FIBer expression Database

Potri.005G044333 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65352 39 / 1e-05 Putative membrane lipoprotein (.1)
AT5G62623 38 / 4e-05 Putative membrane lipoprotein (.1)
AT5G62627 35 / 0.0006 Putative membrane lipoprotein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G044333.1 pacid=42803293 polypeptide=Potri.005G044333.1.p locus=Potri.005G044333 ID=Potri.005G044333.1.v4.1 annot-version=v4.1
ATGGAAAAAGCTTCAGTCAAGTTTGCCTTCTTCGTTGCCCTACTACTCATTGCATCATGCTTGCCCAATGAAGCTAACGCAAGGGAGTTCTCAATAAAGC
AGCAACAAAGGCAATGTAGAGTTCCCTCTGACTGCACGAGCTTGTGCCATGGGTGCACCGTGACACAATGCACTGCTGGTCGTTGTGTGTGCAATTGTGC
TAGCACAATTAGGTCAACAAGCTGA
AA sequence
>Potri.005G044333.1 pacid=42803293 polypeptide=Potri.005G044333.1.p locus=Potri.005G044333 ID=Potri.005G044333.1.v4.1 annot-version=v4.1
MEKASVKFAFFVALLLIASCLPNEANAREFSIKQQQRQCRVPSDCTSLCHGCTVTQCTAGRCVCNCASTIRSTS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G65352 Putative membrane lipoprotein ... Potri.005G044333
[exp]
0 1
Potri.006G157801
[exp]
2.00 0.9180
AT1G28590 GDSL-like Lipase/Acylhydrolase... Potri.013G015200
[exp]
2.64 0.9257
AT1G71250 GDSL-like Lipase/Acylhydrolase... Potri.019G067600
[exp]
7.34 0.9046
AT4G30420 nodulin MtN21 /EamA-like trans... Potri.018G099601
[exp]
8.12 0.8430
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Potri.014G114400
[exp]
11.40 0.6778
AT1G68040 S-adenosyl-L-methionine-depend... Potri.010G104701
[exp]
14.42 0.7734
AT4G23760 Cox19-like CHCH family protein... Potri.001G094750
[exp]
17.86 0.6357
AT4G13550 triglyceride lipases;triglycer... Potri.008G174300
[exp]
18.57 0.6853
Potri.011G106900
[exp]
19.97 0.7615
Potri.011G107301
[exp]
25.09 0.7215

Potri.005G044333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.