Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12620 119 / 1e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 119 / 1e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62720 117 / 2e-31 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G12775 116 / 1e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22470 115 / 1e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G06580 112 / 8e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 113 / 1e-29 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G63630 105 / 1e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G63400 111 / 4e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 110 / 9e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G046200 [exp] 219 / 5e-69 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 206 / 4e-64 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 202 / 9e-63 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050300 [exp] 201 / 3e-62 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046100 [exp] 197 / 1e-60 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 193 / 3e-59 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034400 [exp] 187 / 8e-57 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050400 [exp] 184 / 1e-55 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050180 [exp] 182 / 4e-55 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026935 [exp] 129 / 2e-38 AT3G22470 133 / 2e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039310 [exp] 129 / 1e-37 AT3G22470 226 / 6e-70 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008593 [exp] 131 / 2e-36 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10009201 [exp] 125 / 2e-35 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10022861 [exp] 127 / 8e-35 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 124 / 1e-33 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014242 [exp] 122 / 1e-33 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003433 [exp] 123 / 3e-33 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 122 / 4e-33 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014247 [exp] 121 / 1e-32 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.005G047200.1 pacid=42802987 polypeptide=Potri.005G047200.1.p locus=Potri.005G047200 ID=Potri.005G047200.1.v4.1 annot-version=v4.1 ATGACCGAGGAAGGTGCTGAGCCAAATGTTTACACCTACAATGCCTTGATGGGTGGATATTGTTTAAATAACCAAATGGATGAGGCCCAAAAGGTGCTCG ACATCATGGTTGGCAAGGGTTATGCACCTGCTGTACATAGTTACAACATCTTGACCAATGGAAATTGCAAGAGAAGAAGGCTGGACGAGGCAAAAAGATT ACTTTCTAAAATGTCTGAAAAGGAATTGACTCCTGATACTGTCACTTACAGCACTCTTATGCAAGGTTTCTGCCAAGTAGGGAGACCTCAGGAAGCTCTA AATCTTTTCAACGAGATGTGTTCTTCTGGCCTGCTTCCAAATTTGATGACTTGCTTGAAATTGCTAGATGGCTTTAGGGGGGTCAGCAACAGCTGCTACA GCTATGGAATGGGCATTAGCCAATCTATTCAGCCATCTGATGTTTACCATCATATTAACAGTTTTTAA
AA sequence Show only first row Show all	>Potri.005G047200.1 pacid=42802987 polypeptide=Potri.005G047200.1.p locus=Potri.005G047200 ID=Potri.005G047200.1.v4.1 annot-version=v4.1 MTEEGAEPNVYTYNALMGGYCLNNQMDEAQKVLDIMVGKGYAPAVHSYNILTNGNCKRRRLDEAKRLLSKMSEKELTPDTVTYSTLMQGFCQVGRPQEAL NLFNEMCSSGLLPNLMTCLKLLDGFRGVSNSCYSYGMGISQSIQPSDVYHHINSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12620			Pentatricopeptide repeat (PPR)...		Potri.005G047200 [exp]	0	1
					Potri.001G258150 [exp]	3.16	0.7552
AT4G36050			endonuclease/exonuclease/phosp...		Potri.005G113250 [exp]	7.34	0.7097
					Potri.008G164600 [exp]	9.79	0.7484
					Potri.007G082350 [exp]	10.19	0.7397
AT1G05690		BT3	BTB and TAZ domain protein 3 (...		Potri.017G009700 [exp]	11.83	0.7063
AT3G50860			Clathrin adaptor complex small...		Potri.005G122900 [exp]	19.10	0.7365
AT4G22990			Major Facilitator Superfamily ...		Potri.014G078000 [exp]	26.19	0.7109
AT2G43980		ATITPK4	"inositol 1,3,4-trisphosphate ...		Potri.007G144701 [exp]	28.63	0.6606
					Potri.002G169550 [exp]	28.72	0.6828
AT5G24450			Transcription factor IIIC, sub...		Potri.007G145000 [exp]	30.59	0.7248

Compare expression of checked genes

Potri.005G047200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.