Potri.005G047901 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27990 124 / 7e-36 Pre-rRNA-processing protein TSR2, conserved region (.1)
AT3G22510 80 / 2e-19 Pre-rRNA-processing protein TSR2, conserved region (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G035000 332 / 3e-117 AT5G27990 126 / 1e-36 Pre-rRNA-processing protein TSR2, conserved region (.1)
Potri.010G086800 120 / 5e-35 AT3G22510 98 / 2e-27 Pre-rRNA-processing protein TSR2, conserved region (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006795 202 / 6e-66 AT5G27990 107 / 2e-29 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10005806 197 / 7e-64 AT5G27990 107 / 4e-29 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10027901 116 / 2e-32 AT5G27990 79 / 3e-18 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10002404 112 / 8e-31 AT5G27990 77 / 1e-17 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10006124 93 / 1e-21 AT3G22520 340 / 4e-106 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10273 WGG Pre-rRNA-processing protein TSR2
Representative CDS sequence
>Potri.005G047901.1 pacid=42804239 polypeptide=Potri.005G047901.1.p locus=Potri.005G047901 ID=Potri.005G047901.1.v4.1 annot-version=v4.1
ATGGAGAGCAGCAGCAGCAGCAGCTTAACTGGAGGATTTGGCCAAATTGGGTCCTCAAAACAACTAACAGCAGATTCAATTTCTCAATTCAGAGAAGGTA
TTTGTTTAATTCTTTCTAAATGGTCAGCTTTGCAACTCGCCGTTGAAAACGAATGGGGCGGCCGCGGGTCAGGCCTATTAGCTGAGCAACTCGCCTCTGA
TATCCTCTCTTGGTTCACTCAGTCTAAAGAGCCACTTTTTATTGATGATTTGGAAGGCATCTTGGATGAAGCTATGCTTTCTCTGAATACCATGATTGAT
GATGGCAGCATTGAAGAGGTAGCAGAAAAATTAATGATTATGCATGAAGAATGTTTAGAAGGCAATTATAGTTCTATTCAGAAATTGAGGGAAGCAGCTC
CTAGAACAAGAGCTCATCAACATGTCAAGCAGGCTGTGGACAGTGATGATGATTCTGAGGACAGCGGCAATGATGATAAAATGGGTGATGATGAATCGAA
CATGATGGTGGACGCACCAGAATTCCAATCGAAGATGTATCCAGTAAACAAGCCAGTCAATGTGCCAAGGGCCAAGGAGGCTCAATCAGAAGATGGATGG
ACAGTTGTTTCATCTAGGCGAAACAAGGATAAAAGGAATTAG
AA sequence
>Potri.005G047901.1 pacid=42804239 polypeptide=Potri.005G047901.1.p locus=Potri.005G047901 ID=Potri.005G047901.1.v4.1 annot-version=v4.1
MESSSSSSLTGGFGQIGSSKQLTADSISQFREGICLILSKWSALQLAVENEWGGRGSGLLAEQLASDILSWFTQSKEPLFIDDLEGILDEAMLSLNTMID
DGSIEEVAEKLMIMHEECLEGNYSSIQKLREAAPRTRAHQHVKQAVDSDDDSEDSGNDDKMGDDESNMMVDAPEFQSKMYPVNKPVNVPRAKEAQSEDGW
TVVSSRRNKDKRN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G27990 Pre-rRNA-processing protein TS... Potri.005G047901 0 1
AT5G28060 Ribosomal protein S24e family ... Potri.008G152500 4.69 0.9582
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.018G115400 8.00 0.9447 Pt-RPS11.3
AT3G12390 Nascent polypeptide-associated... Potri.001G034400 9.16 0.9460
AT4G18100 Ribosomal protein L32e (.1) Potri.001G353900 14.14 0.9437 Pt-RPL32.2
AT4G36130 Ribosomal protein L2 family (.... Potri.005G115700 16.43 0.9396 RPL2.2
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.005G072700 18.54 0.9355
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Potri.012G128600 21.21 0.9354 Pt-RPS13.2
AT3G26040 HXXXD-type acyl-transferase fa... Potri.017G010600 23.36 0.8870
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400 25.23 0.9371 RPL17.2
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Potri.005G194500 25.49 0.9345 ARP1.1

Potri.005G047901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.