Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54530 100 / 7e-28 Calcium-binding EF hand family protein (.1) AT2G44310 76 / 2e-18 Calcium-binding EF-hand family protein (.1) AT4G38810 45 / 3e-06 Calcium-binding EF-hand family protein (.1.2) AT1G29020 40 / 0.0002 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G231100 [exp] 83 / 3e-21 AT2G44310 221 / 2e-75 Calcium-binding EF-hand family protein (.1) Potri.002G218500 [exp] 66 / 8e-15 AT2G44310 140 / 7e-44 Calcium-binding EF-hand family protein (.1) Potri.014G161200 [exp] 66 / 2e-14 AT2G44310 143 / 1e-44 Calcium-binding EF-hand family protein (.1) Potri.002G218300 [exp] 64 / 1e-13 AT2G44310 138 / 9e-43 Calcium-binding EF-hand family protein (.1) Potri.002G219000 [exp] 62 / 4e-13 AT2G44310 137 / 1e-42 Calcium-binding EF-hand family protein (.1) Potri.002G218800 [exp] 62 / 4e-13 AT2G44310 137 / 1e-42 Calcium-binding EF-hand family protein (.1) Potri.002G218750 [exp] 62 / 5e-13 AT2G44310 136 / 3e-42 Calcium-binding EF-hand family protein (.1) Potri.002G218201 [exp] 62 / 5e-13 AT2G44310 136 / 4e-42 Calcium-binding EF-hand family protein (.1) Potri.002G218700 [exp] 61 / 7e-13 AT2G44310 137 / 3e-42 Calcium-binding EF-hand family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009192 [exp] 132 / 1e-40 AT2G44310 94 / 1e-25 Calcium-binding EF-hand family protein (.1) Lus10035578 [exp] 90 / 7e-24 AT2G44310 182 / 3e-60 Calcium-binding EF-hand family protein (.1) Lus10008649 [exp] 85 / 5e-22 AT2G44310 177 / 2e-58 Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.005G049900.2 pacid=42803189 polypeptide=Potri.005G049900.2.p locus=Potri.005G049900 ID=Potri.005G049900.2.v4.1 annot-version=v4.1 ATGAGTTTAGCTGTCGTCAACGAGACAACAGTGACAACATTTGTCGAAGACATGAAAGCATTCGAGAACTGTGTCAAGGAATGTTTCGAGATGCTTGATG TAGATGGGGATGGAGTGCTTTCACGATCTGAGCTTCGTGAGGGATTTTGTAAACTTATGTCATTAGGGCATGAATCCAGCAAGAAAGAGAAGATTGACCA TCTTTTCGATACTATTTTCGACAGGTTTGATGAGGATCAAAATGGGAGTATCGATCCTCGAGAGTTCAAGTGCTTGATTAGGGAGCTCATGTTTGCAATG GGACGTGGGTTTGGTAATTCTCCAGTTCTGGTGGCTCTAGAAATAGATAGCTTGCTTATGAAGGCTGTGGAGCATGAATTTGGCCAGATATGA
AA sequence Show only first row Show all	>Potri.005G049900.2 pacid=42803189 polypeptide=Potri.005G049900.2.p locus=Potri.005G049900 ID=Potri.005G049900.2.v4.1 annot-version=v4.1 MSLAVVNETTVTTFVEDMKAFENCVKECFEMLDVDGDGVLSRSELREGFCKLMSLGHESSKKEKIDHLFDTIFDRFDEDQNGSIDPREFKCLIRELMFAM GRGFGNSPVLVALEIDSLLMKAVEHEFGQI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54530			Calcium-binding EF hand family...		Potri.005G049900 [exp]	0	1
AT1G77280			Protein kinase protein with ad...		Potri.005G182800 [exp]	12.48	0.8623
AT5G03300		ADK2	adenosine kinase 2 (.1)		Potri.010G224300 [exp]	14.59	0.8786	ADK2.2
AT1G63120		ATRBL2	RHOMBOID-like 2 (.1)		Potri.001G108700 [exp]	21.42	0.8580
AT1G13440		GAPC2, GAPC-2	GLYCERALDEHYDE-3-PHOSPHATE DEH...		Potri.015G091400 [exp]	22.97	0.8294	Pt-GAPDH1.2
AT1G28100			unknown protein		Potri.001G066000 [exp]	24.08	0.7975
AT3G59500			Integral membrane HRF1 family ...		Potri.014G175900 [exp]	29.66	0.8206
AT1G09575			Protein of unknown function (D...		Potri.019G133400 [exp]	31.17	0.8013
AT1G10385			Vps51/Vps67 family (components...		Potri.016G063700 [exp]	32.71	0.7550
AT5G62700		atgcp3, TUB3	tubulin beta chain 3 (.1)		Potri.001G272800 [exp]	35.42	0.8445
AT5G17920		ATCIMS, ATMETS,...	methionine synthesis 1, COBALA...		Potri.004G190900 [exp]	41.66	0.8384

Compare expression of checked genes

Potri.005G049900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.