Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12700 147 / 7e-41 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G12620 139 / 2e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 136 / 2e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62930 135 / 4e-37 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63080 135 / 5e-37 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63320 124 / 1e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62670 128 / 2e-34 RPF2 rna processing factor 2 (.1) AT3G22470 128 / 3e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62910 124 / 4e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 122 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G050240 [exp] 357 / 9e-122 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050180 [exp] 339 / 1e-114 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 325 / 5e-109 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050400 [exp] 324 / 8e-109 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 322 / 6e-108 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 312 / 3e-104 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050300 [exp] 305 / 2e-101 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046100 [exp] 298 / 2e-98 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 293 / 8e-97 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014244 [exp] 157 / 5e-45 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003433 [exp] 156 / 1e-44 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014242 [exp] 152 / 2e-44 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 154 / 5e-44 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10021074 [exp] 150 / 6e-44 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022861 [exp] 150 / 2e-42 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003446 [exp] 142 / 2e-42 AT1G62930 137 / 2e-37 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014247 [exp] 149 / 5e-42 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008593 [exp] 144 / 3e-40 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10029737 [exp] 144 / 5e-40 AT1G63130 424 / 6e-140 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.005G050060.1 pacid=42802348 polypeptide=Potri.005G050060.1.p locus=Potri.005G050060 ID=Potri.005G050060.1.v4.1 annot-version=v4.1 ATGCAAGGTCTGTGCCAATTAGGAAGACCTAAGGAAGCTCTCAATCTTTTCAAGGAGATGTGTTCTTATGGCCCGCATCCAAATTTGGTGACTTATGTGA TTTTACTAGATGGCTTCTGCAAGCATGGGCATTTGGATGAGGCATTAAAACTGCTCAAGTCAATGAAAGAGAAGAAACTAGAACCTAATATTGTCCATTA TACTATCCTTATTGAAGGCATGTTTATCGCTGGGAAGCTTGAAGTTGCGAAGGAACTATTTTCTAAGCTTTTTGGGGATGGAACACGGCCTGATATACGG ACATACACTGTCATGATCAAGGGACTGCTGAAAGAAGGGCTGTCAGATGAAGCATACGATTTATTTAGAAAAATGGAAGATGATGGCTTCTTGCCAAACA GTTGCTCATATAATGTTATGATTCAAGGATTTCTTCAAAATCAGGACTCATCAACTGCTATACGACTTATTGATGAAATGGTTGGTAAAAGATTCTCGGT GAATTTATCTACATTTCAGATGTTATTGGATTTAGAATCTCAAGATGAAATCATAAGCCAATTTATGCGTGGAAGCTCTCAAGGTAGAAAAATGAAGTGA
AA sequence Show only first row Show all	>Potri.005G050060.1 pacid=42802348 polypeptide=Potri.005G050060.1.p locus=Potri.005G050060 ID=Potri.005G050060.1.v4.1 annot-version=v4.1 MQGLCQLGRPKEALNLFKEMCSYGPHPNLVTYVILLDGFCKHGHLDEALKLLKSMKEKKLEPNIVHYTILIEGMFIAGKLEVAKELFSKLFGDGTRPDIR TYTVMIKGLLKEGLSDEAYDLFRKMEDDGFLPNSCSYNVMIQGFLQNQDSSTAIRLIDEMVGKRFSVNLSTFQMLLDLESQDEIISQFMRGSSQGRKMK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G050060 [exp]	0	1
AT1G04270		RPS15	cytosolic ribosomal protein S1...		Potri.005G055401 [exp]	7.48	0.7367
					Potri.014G022050 [exp]	8.12	0.7227
					Potri.004G046401 [exp]	13.30	0.7046
AT2G23090			Uncharacterised protein family...		Potri.001G296600 [exp]	18.97	0.6966
AT1G58602			LRR and NB-ARC domains-contain...		Potri.011G031312 [exp]	24.24	0.6867
AT5G60230		ATSEN2, SEN2	splicing endonuclease 2 (.1.2)		Potri.009G131500 [exp]	28.00	0.6814	Pt-SEN1.2
AT1G80080		AtRLP17, TMM	TOO MANY MOUTHS, Receptor Like...		Potri.001G202100 [exp]	31.22	0.6513
AT5G35732			unknown protein		Potri.002G222900 [exp]	42.50	0.6581
					Potri.008G206100 [exp]	43.47	0.6548
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.009G053566 [exp]	56.12	0.5979

Compare expression of checked genes

Potri.005G050060 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.