Plant FIBer expression Database

Potri.005G050800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G037900
[exp]
112 / 8e-32 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015934
[exp]
60 / 1e-11 AT2G27410 48 / 3e-06 Domain of unknown function (DUF313) (.1)
PFAM info
Representative CDS sequence
>Potri.005G050800.2 pacid=42803140 polypeptide=Potri.005G050800.2.p locus=Potri.005G050800 ID=Potri.005G050800.2.v4.1 annot-version=v4.1
ATGATGAATCATGGGCACTTTCTATATATGGCTGCATGGATGAGAGAAGCACAAGAGGCGACAAAATTGGTGGAGAACATCGACAGCAGAATAAAGAACA
AAGACTTGGCTGAAGAAATTATGCTTAGAGACATTGCTCAATCTAAGCTCAGGGAAGCTGGAGTCAAACTTGATTGCCTTGGATCATTTCTTCATAATCC
TCCTTCAAAGCCTAACCTTACTTTTACAGAAGTAAAGAAGATTCGGATTTTCGATGAAAAAGCTATCGGATTTACGGCTAAGAACAAGAGCACTGGCTCT
CAATCTCTACGCATCCACATCAACAAGGAGGTACAGTTGGTTTCATGTCCTCATTCCTCTTGA
AA sequence
>Potri.005G050800.2 pacid=42803140 polypeptide=Potri.005G050800.2.p locus=Potri.005G050800 ID=Potri.005G050800.2.v4.1 annot-version=v4.1
MMNHGHFLYMAAWMREAQEATKLVENIDSRIKNKDLAEEIMLRDIAQSKLREAGVKLDCLGSFLHNPPSKPNLTFTEVKKIRIFDEKAIGFTAKNKSTGS
QSLRIHINKEVQLVSCPHSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G050800
[exp]
0 1
AT5G60620 GPAT9 glycerol-3-phosphate acyltrans... Potri.004G183300
[exp]
3.16 0.7064
AT5G54860 Major facilitator superfamily ... Potri.011G137400
[exp]
10.81 0.7602
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G116130
[exp]
20.04 0.7551
Potri.018G142201
[exp]
46.47 0.6266
AT2G34700 Pollen Ole e 1 allergen and ex... Potri.011G053600
[exp]
55.82 0.6885
AT1G11440 unknown protein Potri.004G029500
[exp]
68.37 0.6610
AT3G21510 ATHP3, AHP1 histidine-containing phosphotr... Potri.013G028300
[exp]
70.99 0.6759 Pt-HPT2.2
AT1G79070 SNARE-associated protein-relat... Potri.011G144400
[exp]
75.41 0.6074
AT2G41990 unknown protein Potri.009G140600
[exp]
76.31 0.6825
AT2G33630 NAD(P)-binding Rossmann-fold s... Potri.002G005100
[exp]
81.71 0.6180

Potri.005G050800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.