Potri.005G052100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04780 310 / 1e-109 Protein of unknown function (DUF1000) (.1)
AT2G25950 59 / 6e-11 Protein of unknown function (DUF1000) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G039500 342 / 3e-122 AT3G04780 310 / 9e-110 Protein of unknown function (DUF1000) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001780 291 / 3e-102 AT3G04780 295 / 8e-104 Protein of unknown function (DUF1000) (.1)
Lus10020246 267 / 7e-91 AT3G04780 265 / 7e-90 Protein of unknown function (DUF1000) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0202 GBD PF06201 PITH PITH domain
Representative CDS sequence
>Potri.005G052100.1 pacid=42802836 polypeptide=Potri.005G052100.1.p locus=Potri.005G052100 ID=Potri.005G052100.1.v4.1 annot-version=v4.1
ATGTCTGCAGAATCAGCCACTGCAATTCCAAGGGGCCAAGTTGATTTGTTGGATTTTATTGATTTTTCTGGAGTTGAATGTCTTAACCAAAGCACAAGCC
ACTCTCTTTCGAATGCTATCAAGCAGGGTTATAGAGAAGATGATGGTTTGAATCTAGAAAGTGATGCGGATGAGCAGTTGCTGATTCATATACCTTTCAA
TCAAGTTATTAAACTGCATTCTATTGCCATCAAAGGACCTGAAGAAGATGGTCCAAAGACGGTAAAACTTTTTTCAAACAAGGAGCATATGGGATTTAGC
AATGTCAACGATTACCCTCCAAGTGACACTGTAGTTTTATCCCCGGATACTCTTAAGGGAAAACCTGTGGTGTTGAAATATGTCAAGTTTCAGAATGTTC
GTAGCTTGACAATATTTATCAAGGATAATCAATTAGATTCGGAGATCACAAAAGTTCAAAAGATTGCTTTGTTCGGAACAACGGTGGAAACAACAGACAT
GAAGAGTCTGAAGAAGATTGAGGATCACTAA
AA sequence
>Potri.005G052100.1 pacid=42802836 polypeptide=Potri.005G052100.1.p locus=Potri.005G052100 ID=Potri.005G052100.1.v4.1 annot-version=v4.1
MSAESATAIPRGQVDLLDFIDFSGVECLNQSTSHSLSNAIKQGYREDDGLNLESDADEQLLIHIPFNQVIKLHSIAIKGPEEDGPKTVKLFSNKEHMGFS
NVNDYPPSDTVVLSPDTLKGKPVVLKYVKFQNVRSLTIFIKDNQLDSEITKVQKIALFGTTVETTDMKSLKKIEDH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G04780 Protein of unknown function (D... Potri.005G052100 0 1
AT1G08770 PRA1.E prenylated RAB acceptor 1.E (.... Potri.005G054700 6.48 0.6494
AT1G23750 Nucleic acid-binding, OB-fold-... Potri.010G041000 11.48 0.6747
AT4G25720 ATQC, QCT GLUTAMINYL CYCLOTRANSFERASE, A... Potri.017G146200 11.61 0.6725
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.001G057500 16.70 0.6791
AT5G55990 ATCBL2, CBL2 calcineurin B-like protein 2 (... Potri.016G003500 25.98 0.6248
AT5G65260 RNA-binding (RRM/RBD/RNP motif... Potri.001G311600 26.98 0.6392
AT4G11260 RPR1, ETA3, EDM... ENHANCER OF TIR1-1 AUXIN RESIS... Potri.017G149800 31.44 0.6124
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Potri.002G145200 36.19 0.6662
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Potri.009G087400 38.85 0.6431
AT3G44150 unknown protein Potri.006G201600 45.36 0.6050

Potri.005G052100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.