Potri.005G053750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G43760 53 / 7e-09 DNAse I-like superfamily protein (.1)
AT1G40390 47 / 2e-06 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G175087 114 / 7e-34 AT1G43760 42 / 1e-05 DNAse I-like superfamily protein (.1)
Potri.010G013850 65 / 1e-13 AT1G40390 45 / 7e-06 DNAse I-like superfamily protein (.1)
Potri.012G063901 62 / 6e-12 AT1G43760 266 / 1e-80 DNAse I-like superfamily protein (.1)
Potri.009G000601 60 / 8e-12 AT1G43760 109 / 9e-28 DNAse I-like superfamily protein (.1)
Potri.004G128961 59 / 5e-11 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128860 59 / 5e-11 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128880 59 / 5e-11 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128921 59 / 5e-11 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128901 59 / 5e-11 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G053750.1 pacid=42805526 polypeptide=Potri.005G053750.1.p locus=Potri.005G053750 ID=Potri.005G053750.1.v4.1 annot-version=v4.1
ATGATGGCTATCTGCAACCTGGTTGATCTGGGATATCAGGGGCTGGGGTTCACTTGGCACTGTCACATCCATGGTGGTCGGTATTTGGCTAAAAGTCTCG
ATAGAGCCTTATCAAATCTTGAATGGCACATAACCTTTCCCGAAGCATTTGTAGAGAACTTATGTCGTCTCTATTCTGACCATAATCCGATTATTCTGCG
ATTTGGTAGAAAGCAGGCCAGGGCTGGTGGTGGACCTTTCAAATTTGAAGAGGCTTGGACTACCCATCCCAGTTACCAAGAACTTGTCAGTAATGCTTGG
GGGAGAAGTGACCATAACGTTCTTCAAGGTCTTCAAGAAGTTCGTCAGGACTCTATTGACTTCAATAAAAACATTTTCGGTAACATTTTCCAGCGGAAAA
GAAGGCTTGAAGCAAGGTTAAATGGTATTCAGCGTTGA
AA sequence
>Potri.005G053750.1 pacid=42805526 polypeptide=Potri.005G053750.1.p locus=Potri.005G053750 ID=Potri.005G053750.1.v4.1 annot-version=v4.1
MMAICNLVDLGYQGLGFTWHCHIHGGRYLAKSLDRALSNLEWHITFPEAFVENLCRLYSDHNPIILRFGRKQARAGGGPFKFEEAWTTHPSYQELVSNAW
GRSDHNVLQGLQEVRQDSIDFNKNIFGNIFQRKRRLEARLNGIQR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G43760 DNAse I-like superfamily prote... Potri.005G053750 0 1
Potri.008G206866 18.86 0.7891
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Potri.004G045800 22.51 0.7884
Potri.005G135601 30.00 0.7805
Potri.003G034132 32.24 0.7453
AT4G17565 F-box family protein with a do... Potri.004G134900 37.52 0.7720
AT1G43760 DNAse I-like superfamily prote... Potri.014G188801 43.26 0.7694
AT3G54940 Papain family cysteine proteas... Potri.010G228400 48.33 0.7597
AT5G14990 unknown protein Potri.010G222200 49.19 0.7674
AT1G59610 DRP2B, CF1, ADL... Dynamin related protein 2B, dy... Potri.013G096701 54.74 0.6827
AT1G32583 unknown protein Potri.010G145501 61.15 0.7538

Potri.005G053750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.