Potri.005G054700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08770 138 / 8e-41 PRA1.E prenylated RAB acceptor 1.E (.1)
AT1G55190 134 / 1e-39 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT3G13710 120 / 3e-34 PRA1.F4 prenylated RAB acceptor 1.F4 (.1)
AT3G13720 113 / 2e-31 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1)
AT2G38360 110 / 8e-30 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT3G56110 108 / 4e-29 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT2G40380 106 / 3e-28 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G01640 103 / 2e-27 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT5G05380 103 / 3e-27 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT1G04260 100 / 1e-26 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G219100 190 / 2e-61 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G044000 166 / 6e-52 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G043800 148 / 6e-45 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.003G035200 135 / 5e-40 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.010G183300 108 / 3e-29 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.006G104400 96 / 3e-24 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.019G124100 94 / 7e-24 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.016G126400 92 / 7e-23 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.008G074000 91 / 2e-22 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021996 169 / 7e-53 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1)
Lus10042535 162 / 6e-50 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1)
Lus10033859 144 / 4e-43 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10015631 144 / 4e-43 AT1G55190 193 / 7e-63 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10014747 142 / 2e-42 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10034363 135 / 1e-39 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10037649 130 / 2e-38 AT1G55190 153 / 2e-47 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10005088 131 / 3e-38 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10042246 124 / 9e-35 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10024861 122 / 2e-34 AT1G08770 132 / 2e-38 prenylated RAB acceptor 1.E (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Potri.005G054700.1 pacid=42803592 polypeptide=Potri.005G054700.1.p locus=Potri.005G054700 ID=Potri.005G054700.1.v4.1 annot-version=v4.1
ATGTCACGAAAAGCACAAGCAGGTTATGGCACCATCCCCACCACCATCAGCGCAACCACAACCACCACCACAAAATCCCCACAATCACCAACCACCCTGA
CATTCATCTCACGCGTCAGCACTTCAACTCAAACCCTCATAGCCACGCGCCGTCCATGGCAAGAACTTATAAAGTTATCATCTTTCATTCGCCCTAACAA
TTATAATGACGCCATTTCACGCATCAAATTCAACGTCAATTACTTTCGTGTGAATTATGCAATGATATTTCTTGCAATCTTATTTTTAAGTCTTTTGTGG
CATCCAATTTCTATGATTGTGTTTATTGTGATGTTTGTCGCGTGGTTGTTTCTATATTTCGGACGTGATGGTCCGGTGGTGGTGTTTAATAAAAGTCTTG
ATGACAGAGTTGTTTTGTGTGTGCTTGGATTGGTTACTATATTGGCGTTGGTGTTTACTCATGTGGGTTTGAATGTTCTGATTGCTTTGATTATTGGGGT
GGTGATTGTTGGAGTTCACGCCGCGTTTAGGGGCACCGAGGATTTGTTTCTTGATGAGGAAAGTGCTGTTGAAGGTGGATTGCTTTCGGTTGTTGGTAGT
CAGCCTTTGCGACCCACAATGGGTTATACTCGGATTTGA
AA sequence
>Potri.005G054700.1 pacid=42803592 polypeptide=Potri.005G054700.1.p locus=Potri.005G054700 ID=Potri.005G054700.1.v4.1 annot-version=v4.1
MSRKAQAGYGTIPTTISATTTTTTKSPQSPTTLTFISRVSTSTQTLIATRRPWQELIKLSSFIRPNNYNDAISRIKFNVNYFRVNYAMIFLAILFLSLLW
HPISMIVFIVMFVAWLFLYFGRDGPVVVFNKSLDDRVVLCVLGLVTILALVFTHVGLNVLIALIIGVVIVGVHAAFRGTEDLFLDEESAVEGGLLSVVGS
QPLRPTMGYTRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G08770 PRA1.E prenylated RAB acceptor 1.E (.... Potri.005G054700 0 1
AT3G04780 Protein of unknown function (D... Potri.005G052100 6.48 0.6494
AT5G05760 ATSYP31, ATSED5... T-SNARE SED 5, syntaxin of pla... Potri.010G191100 12.52 0.7143 Pt-SYP31.1
AT3G44150 unknown protein Potri.006G201600 15.81 0.6256
Potri.001G135100 17.32 0.7091
AT2G30410 TFCA, KIS TUBULIN FOLDING FACTOR A, tubu... Potri.013G071100 23.57 0.6545 TFCFA,Pt-KIS.1
AT5G52870 MAKR5 MEMBRANE-ASSOCIATED KINASE REG... Potri.015G027500 33.82 0.6091
AT2G32720 B5 #4, B5#4, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Potri.017G054300 39.77 0.6404
AT3G25250 AtOXI1, OXI1, A... oxidative signal-inducible1, A... Potri.002G248900 41.42 0.5988
AT5G55990 ATCBL2, CBL2 calcineurin B-like protein 2 (... Potri.016G003500 42.40 0.5995
AT4G32570 ZIM TIFY8 TIFY domain protein 8 (.1) Potri.006G247500 43.86 0.5930

Potri.005G054700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.