Potri.005G055000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45400 145 / 3e-43 exostosin family protein (.1)
AT3G03650 132 / 6e-38 EDA5 embryo sac development arrest 5, Exostosin family protein (.1)
AT1G74680 120 / 6e-34 Exostosin family protein (.1)
AT1G67410 97 / 4e-25 Exostosin family protein (.1)
AT5G44930 93 / 8e-24 ARAD2 ARABINAN DEFICIENT 2, Exostosin family protein (.1.2)
AT2G35100 91 / 5e-23 ARAD1 ARABINAN DEFICIENT 1, Exostosin family protein (.1)
AT1G34270 79 / 8e-19 Exostosin family protein (.1)
AT5G16890 79 / 1e-18 Exostosin family protein (.1)
AT3G42180 57 / 5e-11 Exostosin family protein (.1.3)
AT5G33290 55 / 4e-10 XGD1 xylogalacturonan deficient 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G044600 166 / 7e-51 AT3G45400 607 / 0.0 exostosin family protein (.1)
Potri.013G067400 166 / 9e-51 AT3G45400 587 / 0.0 exostosin family protein (.1)
Potri.002G210000 135 / 3e-39 AT1G74680 565 / 0.0 Exostosin family protein (.1)
Potri.008G034500 105 / 4e-28 AT1G67410 557 / 0.0 Exostosin family protein (.1)
Potri.012G124600 90 / 1e-22 AT2G35100 604 / 0.0 ARABINAN DEFICIENT 1, Exostosin family protein (.1)
Potri.015G124800 90 / 1e-22 AT2G35100 581 / 0.0 ARABINAN DEFICIENT 1, Exostosin family protein (.1)
Potri.019G086800 82 / 6e-20 AT1G34270 655 / 0.0 Exostosin family protein (.1)
Potri.013G116200 79 / 1e-18 AT1G34270 660 / 0.0 Exostosin family protein (.1)
Potri.019G049800 76 / 2e-17 AT5G16890 693 / 0.0 Exostosin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013627 146 / 1e-44 AT3G45400 524 / 0.0 exostosin family protein (.1)
Lus10020308 149 / 2e-44 AT3G45400 622 / 0.0 exostosin family protein (.1)
Lus10003870 149 / 4e-44 AT3G45400 644 / 0.0 exostosin family protein (.1)
Lus10005684 147 / 6e-43 AT3G45400 619 / 0.0 exostosin family protein (.1)
Lus10002060 114 / 2e-31 AT1G74680 537 / 0.0 Exostosin family protein (.1)
Lus10024214 109 / 7e-30 AT1G74680 468 / 3e-163 Exostosin family protein (.1)
Lus10015791 99 / 5e-26 AT1G67410 595 / 0.0 Exostosin family protein (.1)
Lus10037016 99 / 1e-25 AT1G67410 590 / 0.0 Exostosin family protein (.1)
Lus10038355 94 / 7e-24 AT2G35100 605 / 0.0 ARABINAN DEFICIENT 1, Exostosin family protein (.1)
Lus10036219 93 / 1e-23 AT2G35100 611 / 0.0 ARABINAN DEFICIENT 1, Exostosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03016 Exostosin Exostosin family
Representative CDS sequence
>Potri.005G055000.1 pacid=42804786 polypeptide=Potri.005G055000.1.p locus=Potri.005G055000 ID=Potri.005G055000.1.v4.1 annot-version=v4.1
ATGCACTCCTCTAAATTTTGCCTTGACATAGCAAGTGACACGCCCTCATCAAATCGCCTCATTGATGCCATTGCTAGCCACTGTGTTCCGGTCATCATCA
GTGATGACATTGAGTTCCCTTATGAGGATGTCATTGATTACTCTCAATTCTGTATATCTGTTCGCACATCAAATGTTGTTAGAGAAAAGTTCCTCGTAAA
TCTCATCAGTAGTATTAAGAATGATGAATGGACTAGAATGTGGAAGATGTTGAAAGAGGTAGAAAATTTCTGA
AA sequence
>Potri.005G055000.1 pacid=42804786 polypeptide=Potri.005G055000.1.p locus=Potri.005G055000 ID=Potri.005G055000.1.v4.1 annot-version=v4.1
MHSSKFCLDIASDTPSSNRLIDAIASHCVPVIISDDIEFPYEDVIDYSQFCISVRTSNVVREKFLVNLISSIKNDEWTRMWKMLKEVENF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G45400 exostosin family protein (.1) Potri.005G055000 0 1
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Potri.005G054900 1.00 0.9169
AT1G63690 ATSPPL2 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Potri.001G103100 4.89 0.8816
AT5G01270 CPL2, ATCPL2 carboxyl-terminal domain (ctd)... Potri.006G099402 13.41 0.8648
AT5G51980 C3HZnF Transducin/WD40 repeat-like su... Potri.014G077800 14.49 0.8421
Potri.010G029350 24.00 0.8359
AT5G04760 MYB Duplicated homeodomain-like su... Potri.008G016175 25.74 0.8252
Potri.007G113550 25.90 0.8095
AT3G42170 BED zinc finger ;hAT family di... Potri.017G019466 26.55 0.8704
AT1G09330 ECHIDNA, ECH unknown protein Potri.002G191700 28.98 0.7813
AT2G39090 APC7, AtAPC7 anaphase-promoting complex 7, ... Potri.008G215100 37.94 0.8039

Potri.005G055000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.