Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04270 77 / 7e-19 RPS15 cytosolic ribosomal protein S15 (.1.2) AT5G09510 76 / 2e-18 Ribosomal protein S19 family protein (.1.2) AT5G43640 68 / 2e-15 Ribosomal protein S19 family protein (.1) AT5G09500 68 / 2e-15 Ribosomal protein S19 family protein (.1) AT5G09490 67 / 5e-15 Ribosomal protein S19 family protein (.1) AT2G15530 53 / 5e-09 RING/U-box superfamily protein (.1.2.3.4) AT5G63070 49 / 8e-08 Ribosomal protein S19 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G055401 [exp] 132 / 2e-41 AT1G04270 97 / 3e-27 cytosolic ribosomal protein S15 (.1.2) Potri.005G055667 [exp] 97 / 2e-27 AT2G15530 52 / 3e-09 RING/U-box superfamily protein (.1.2.3.4) Potri.010G076900 [exp] 76 / 1e-18 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2) Potri.002G043200 [exp] 76 / 3e-18 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1) Potri.005G219700 [exp] 75 / 4e-18 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1) Potri.011G103401 [exp] 70 / 1e-16 AT2G15530 51 / 8e-09 RING/U-box superfamily protein (.1.2.3.4) Potri.011G103301 [exp] 70 / 5e-16 AT2G15530 52 / 4e-08 RING/U-box superfamily protein (.1.2.3.4) Potri.008G161901 [exp] 45 / 3e-07 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021886 [exp] 82 / 2e-19 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1) Lus10024865 [exp] 76 / 2e-18 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1) Lus10018777 [exp] 76 / 2e-18 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2) Lus10033856 [exp] 76 / 3e-18 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2) Lus10041168 [exp] 77 / 9e-18 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2) Lus10007469 [exp] 72 / 1e-16 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1) Lus10026127 [exp] 65 / 5e-14 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1) Lus10008692 [exp] 55 / 2e-10 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00203 [poplar] [flax] Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence Show only first row Show all	>Potri.005G055534.1 pacid=42803182 polypeptide=Potri.005G055534.1.p locus=Potri.005G055534 ID=Potri.005G055534.1.v4.1 annot-version=v4.1 ATGGTATATTTTGAGTATAGTCTGTGGTCTACTCTGTTTTTCGGTGGCTTGGAACCGAAAAGGGAGGCCCCAGATGGTGAGAAGCCAGAGCCCTTGAGGA CTCATCTTAGAAATATGATCATTGTGCCCGAGATGATTGGCCGTTATCTTTCTGGGTTCTCAGTTTCTTACAAGCCCGTTATGCATGGAAGACCTGGACA CAGACTTCCAGATTCATTCCTCTCAATTGTCCCTTCGGGGACATCCGATAAAATTGGAACGATACAGAGAAGATTAGCATGGCCCCTGCGCAAGGATGAC ACGCACAAATCGAGAAATGGTGGGTGTGGAGACGGAAGTAACAGTGGCGAGAGGGTAGCCAAAGAAGAGAGCTTTCAAGAAGTTCAGTTTTAG
AA sequence Show only first row Show all	>Potri.005G055534.1 pacid=42803182 polypeptide=Potri.005G055534.1.p locus=Potri.005G055534 ID=Potri.005G055534.1.v4.1 annot-version=v4.1 MVYFEYSLWSTLFFGGLEPKREAPDGEKPEPLRTHLRNMIIVPEMIGRYLSGFSVSYKPVMHGRPGHRLPDSFLSIVPSGTSDKIGTIQRRLAWPLRKDD THKSRNGGCGDGSNSGERVAKEESFQEVQF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04270		RPS15	cytosolic ribosomal protein S1...		Potri.005G055534 [exp]	0	1
AT4G31805			WRKY family transcription fact...		Potri.006G263800 [exp]	2.00	0.8351
AT3G21740		APO4	ACCUMULATION OF PHOTOSYSTEM ON...		Potri.017G037200 [exp]	2.23	0.8681
					Potri.019G026101 [exp]	6.70	0.8347
AT3G58610			ketol-acid reductoisomerase (....		Potri.004G043700 [exp]	6.70	0.7958	Pt-PGAAIR.3
AT3G04710		TPR10	tetratricopeptide repeat 10, a...		Potri.013G042300 [exp]	7.41	0.8016
AT2G28605			Photosystem II reaction center...		Potri.005G068500 [exp]	7.54	0.8417
AT3G30460			RING/U-box superfamily protein...		Potri.013G116000 [exp]	7.87	0.7415
AT5G47540			Mo25 family protein (.1)		Potri.010G155300 [exp]	10.39	0.7942
					Potri.006G028101 [exp]	13.34	0.8471
					Potri.018G145574 [exp]	14.96	0.7771

Compare expression of checked genes

Potri.005G055534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.