Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15530 53 / 1e-09 RING/U-box superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G055534 [exp] 97 / 2e-27 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2) Potri.011G103401 [exp] 75 / 2e-19 AT2G15530 51 / 8e-09 RING/U-box superfamily protein (.1.2.3.4) Potri.011G103301 [exp] 71 / 3e-17 AT2G15530 52 / 4e-08 RING/U-box superfamily protein (.1.2.3.4) Potri.010G076900 [exp] 37 / 0.0003 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2) Potri.002G043200 [exp] 37 / 0.0004 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1) Potri.005G219700 [exp] 37 / 0.0004 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041168 [exp] 39 / 0.0002 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2) Lus10021886 [exp] 39 / 0.0002 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1) Lus10024865 [exp] 37 / 0.0004 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1) Lus10018777 [exp] 37 / 0.0006 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2) Lus10033856 [exp] 37 / 0.0006 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G055667.1 pacid=42804528 polypeptide=Potri.005G055667.1.p locus=Potri.005G055667 ID=Potri.005G055667.1.v4.1 annot-version=v4.1 ATGACGTATTTAAGTAAGCGAAGCAGAGACCTGTTAGTTGTCCCTTCGGGGACATCCGATAAAATTGGAACGATACAGAGAAGATTAGCATGGCCCCTGC GCAAGGATGACACGCACAAATCGAGAAATGGTGGGTGTGGGGACGGAAGTAACAGTAGCGAGAGGGTAGCCAAGCTCTTTACCGCCAGAGCGTGCTGCAG GTTTCAAAGAGGTGTGCAGAGGAAGCCAACGGTGTTATTGGCTGTTTGCTGTTGA
AA sequence Show only first row Show all	>Potri.005G055667.1 pacid=42804528 polypeptide=Potri.005G055667.1.p locus=Potri.005G055667 ID=Potri.005G055667.1.v4.1 annot-version=v4.1 MTYLSKRSRDLLVVPSGTSDKIGTIQRRLAWPLRKDDTHKSRNGGCGDGSNSSERVAKLFTARACCRFQRGVQRKPTVLLAVCC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G15530			RING/U-box superfamily protein...		Potri.005G055667 [exp]	0	1
AT3G04890			Uncharacterized conserved prot...		Potri.013G037050 [exp]	2.44	0.8754
AT2G32235			unknown protein		Potri.004G028100 [exp]	3.87	0.9102
AT4G31805			WRKY family transcription fact...		Potri.006G263800 [exp]	7.93	0.7696
					Potri.018G003201 [exp]	11.22	0.8244
AT4G34760			SAUR-like auxin-responsive pro...		Potri.007G012800 [exp]	13.96	0.7287	SAUR28
AT1G04270		RPS15	cytosolic ribosomal protein S1...		Potri.005G055534 [exp]	16.52	0.7922
AT3G18650	MADS	AGL103	AGAMOUS-like 103 (.1)		Potri.010G238900 [exp]	16.88	0.7733
					Potri.010G212850 [exp]	18.13	0.8040
					Potri.012G102400 [exp]	21.35	0.7592
AT5G56320		ATHEXPALPHA1.5,...	EXPANSIN 14, expansin A14 (.1)		Potri.003G223501 [exp]	21.42	0.8018

Compare expression of checked genes

Potri.005G055667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.