Plant FIBer expression Database

Potri.005G057800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18690 125 / 1e-35 MKS1 MAP kinase substrate 1 (.1)
AT1G21326 67 / 2e-13 VQ motif-containing protein (.1)
AT1G68450 64 / 1e-12 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
AT1G21320 58 / 8e-10 nucleotide binding;nucleic acid binding (.1.2)
AT3G18360 48 / 2e-06 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G110100
[exp]
285 / 7e-99 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
Potri.005G189300
[exp]
114 / 4e-31 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1)
Potri.002G070600
[exp]
96 / 2e-24 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1)
Potri.012G055900
[exp]
59 / 8e-11 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1)
Potri.006G199300
[exp]
55 / 4e-10 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.015G046600
[exp]
52 / 3e-08 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1)
Potri.010G123700
[exp]
50 / 3e-07 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.016G046000
[exp]
44 / 3e-05 AT3G58000 120 / 1e-34 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029768
[exp]
84 / 4e-20 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Lus10042794
[exp]
67 / 4e-14 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1)
Lus10009033
[exp]
60 / 7e-11 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
Lus10028604
[exp]
48 / 1e-06 ND /
Lus10012286
[exp]
42 / 2e-05 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.005G057800.1 pacid=42805594 polypeptide=Potri.005G057800.1.p locus=Potri.005G057800 ID=Potri.005G057800.1.v4.1 annot-version=v4.1
ATGGACCCCTACCAGTATCCCACCACCGGCAAACCGCCACAACGGCCACCGCCACCGCCACCATCTCCAAAAAAAGAAATTCAAATCCAAGGCCCTAGAC
CTTCAGCGCTAAGACTCCACCAGGGCTCTCACAAAATCAAGAAGCCACCCCTCCCTCCTCAAAGACAACCTGTCATCATCTATGCAGTCTCTCCAAAGAT
CATCCACGCAGAGGAATCCAACTTCATGGCCGTCGTCCAGCGGTTAACAGGTCTCTCCTCCGCTGATTTCTCCCACGACGGGTCTGTTTCTCCAGCTGCA
AGACTTGCTGCCACTGAGAAAGCAAGTCCAAGAGAATTAACTAGACCAAGTACCATTAATGATAGTAGTAATGATGATCTCATGGAGATGATTGAAGAAC
TGGATTTTGGTCAATTTCCAGGGATCTTGTCACCGGCACCAGCGATGTTACCGCCGGTACCAACTGGGTTCTTCTCACCCGTGTCAACGGATGCAAATAT
TTCACAATCTTTCTGGAATGATAATTATAGTATGAGTCCATTATTTACGGCCAGCCCTTCAGGTTTCTTTTCAGGTTCTGGTATAGTTTCTCCTCTACAT
TCACCAGATATTTTTAGCAGCCTGTTCATGGATCTCTAG
AA sequence
>Potri.005G057800.1 pacid=42805594 polypeptide=Potri.005G057800.1.p locus=Potri.005G057800 ID=Potri.005G057800.1.v4.1 annot-version=v4.1
MDPYQYPTTGKPPQRPPPPPPSPKKEIQIQGPRPSALRLHQGSHKIKKPPLPPQRQPVIIYAVSPKIIHAEESNFMAVVQRLTGLSSADFSHDGSVSPAA
RLAATEKASPRELTRPSTINDSSNDDLMEMIEELDFGQFPGILSPAPAMLPPVPTGFFSPVSTDANISQSFWNDNYSMSPLFTASPSGFFSGSGIVSPLH
SPDIFSSLFMDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G18690 MKS1 MAP kinase substrate 1 (.1) Potri.005G057800
[exp]
0 1
AT2G42010 PLDBETA1 phospholipase D beta 1 (.1) Potri.001G112100
[exp]
1.41 0.9410
AT1G34370 C2H2ZnF STOP1 sensitive to proton rhizotoxic... Potri.007G094100
[exp]
2.00 0.9322
AT1G34320 Protein of unknown function (D... Potri.019G001500
[exp]
2.44 0.9276
AT5G48380 BIR1 BAK1-interacting receptor-like... Potri.002G240000
[exp]
3.16 0.9227
AT1G07530 GRAS SCL14, ATGRAS2 GRAS \(GAI, RGA, SCR\) 2, ARAB... Potri.001G241800
[exp]
3.46 0.9115
AT3G14470 NB-ARC domain-containing disea... Potri.017G143433
[exp]
6.32 0.9260
AT1G53440 Leucine-rich repeat transmembr... Potri.001G385600
[exp]
7.74 0.8922
AT4G40080 ENTH/ANTH/VHS superfamily prot... Potri.005G160800
[exp]
8.06 0.8947
AT1G55020 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, li... Potri.005G032600
[exp]
8.36 0.9112
AT4G27220 NB-ARC domain-containing disea... Potri.018G145530
[exp]
9.79 0.8950

Potri.005G057800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.