Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrTrxm3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03520 157 / 5e-49 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G03680 151 / 8e-47 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT3G15360 151 / 1e-46 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT2G15570 120 / 1e-34 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT1G43560 87 / 8e-22 ATY2 thioredoxin Y2 (.1) AT1G76760 85 / 5e-21 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G50320 80 / 8e-19 ATHX, ATX thioredoxin X (.1) AT4G12170 76 / 1e-17 Thioredoxin superfamily protein (.1) AT5G42980 68 / 4e-15 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 68 / 6e-15 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G073000 [exp] 207 / 1e-68 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 204 / 1e-67 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 182 / 6e-59 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.011G120700 [exp] 176 / 1e-56 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.019G111200 [exp] 154 / 8e-48 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.013G132200 [exp] 154 / 2e-47 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 131 / 5e-39 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.007G074000 [exp] 87 / 8e-22 AT1G50320 201 / 3e-66 thioredoxin X (.1) Potri.005G193400 [exp] 87 / 1e-21 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029752 [exp] 184 / 9e-60 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 184 / 1e-59 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 180 / 2e-58 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014798 [exp] 173 / 2e-55 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 171 / 8e-55 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014069 [exp] 127 / 3e-37 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10019847 [exp] 126 / 5e-37 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10028569 [exp] 82 / 1e-19 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10018875 [exp] 82 / 1e-19 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10037228 [exp] 71 / 6e-16 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF14595 [poplar] [flax] Thioredoxin_9 Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.005G058400.1 pacid=42805073 polypeptide=Potri.005G058400.1.p locus=Potri.005G058400 ID=Potri.005G058400.1.v4.1 annot-version=v4.1 ATGGCTCTTCACGCAAGCATGAATATGAGCACCATGTCGACTACTAGAGCTGGAGTATTATGTTCAAACCATGTAGCTTGCTCAAAAGAGAAGTTGAAAT TGCCCACAGGCAGGGGGTTAAGGAGGTCTTCTTCTTTGTCATTTCCATCTTCTTTCTCTTCTTCATATGCTTCAGTCAAAAATCATAAATCCACCATTGT ATGCAAAGCTCAAGAAGCTGTCGGTGTAGTGCAAGTGGTGACAGATTCAAGCTGGGATAGCCTGGTTATTGGCTGTGAAATCCCAGTTCTAGTTGAATTC TGGGCACCATGGTGCGGACCATGCCGAATGATAACACCGGTGATTGATGAATTGGCAGCAGAATACGCAGGAAAGATTGCTTGTTTCAAAGTGAACACTG ATGATTGCCCAAACATTGCATCACAATATGCGATTAGAAGCATTCCCACAGTGCTAATGTTCAAGAATGGAGAGAAGAAGGAAGGTGTTATAGGTGCAGT TCCAAAGGCTACCTTGGCTGCTGCCATTGAAAAATACGTTGAAGCTTGA
AA sequence Show only first row Show all	>Potri.005G058400.1 pacid=42805073 polypeptide=Potri.005G058400.1.p locus=Potri.005G058400 ID=Potri.005G058400.1.v4.1 annot-version=v4.1 MALHASMNMSTMSTTRAGVLCSNHVACSKEKLKLPTGRGLRRSSSLSFPSSFSSSYASVKNHKSTIVCKAQEAVGVVQVVTDSSWDSLVIGCEIPVLVEF WAPWCGPCRMITPVIDELAAEYAGKIACFKVNTDDCPNIASQYAIRSIPTVLMFKNGEKKEGVIGAVPKATLAAAIEKYVEA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G03520		ATHM2	Thioredoxin superfamily protei...		Potri.005G058400 [exp]	0	1	PtrTrxm3
AT3G26900		ATSKL1	Arabidopsis thaliana shikimate...		Potri.017G062800 [exp]	1.41	0.9890	SK1
AT1G12250			Pentapeptide repeat-containing...		Potri.003G112900 [exp]	2.44	0.9820
AT3G09210		PTAC13	plastid transcriptionally acti...		Potri.006G094800 [exp]	2.44	0.9884
AT5G52440		HCF106	HIGH CHLOROPHYLL FLUORESCENCE ...		Potri.012G144300 [exp]	3.16	0.9778	Pt-HCF106.2
AT3G19490		ATNHD1	ARABIDOPSIS THALIANA NA/H ANTI...		Potri.001G301000 [exp]	3.74	0.9808	NHD1.2
AT3G02100			UDP-Glycosyltransferase superf...		Potri.004G123500 [exp]	4.89	0.9747
AT4G29060		EMB2726	embryo defective 2726, elongat...		Potri.018G083900 [exp]	5.00	0.9821
AT2G22780		PMDH1	peroxisomal NAD-malate dehydro...		Potri.001G287400 [exp]	6.00	0.9787	MDHG.2
AT4G19100		PAM68	photosynthesis affected mutant...		Potri.001G132001 [exp]	6.00	0.9831
AT1G56050			GTP-binding protein-related (....		Potri.001G457900 [exp]	6.92	0.9648

Compare expression of checked genes

Potri.005G058400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.