Potri.005G061366 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61420 232 / 2e-73 BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) (.1)
AT1G55750 232 / 3e-73 BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G107400 366 / 3e-125 AT1G55750 645 / 0.0 BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007089 290 / 1e-95 AT1G55750 546 / 0.0 BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) (.1)
Lus10020465 290 / 3e-95 AT1G55750 607 / 0.0 BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) (.1)
PFAM info
Representative CDS sequence
>Potri.005G061366.1 pacid=42802349 polypeptide=Potri.005G061366.1.p locus=Potri.005G061366 ID=Potri.005G061366.1.v4.1 annot-version=v4.1
ATGATGGAAATTGACGATCTTCAGGCGTCAATTGATCTTCCTTTGGCACCGCTTTCTATCAAGGATCCAAGGGATTACTTTGATTCTCAACAAGCTAGTG
CTCTTAAAACTTCCAGAGATACCAGTATCGGAAATGATCCAGTAAGATGCACCCTGAGTGTGGAAGAATCATATGCTTCTTTGAGGGACTCTATTTCCCA
CATAAAAAACACAGGATTGGTTGATCCCATGGTTACACCTGAAGTTGCTGCTAAGGTCCTTTTGGTCTTGACCCACAATATCTCAAGCACCAAATATGAT
CTTGGGAAGAATCCCGGGCTAAGTGTTTTGGACACGTTGCCAAATTCAATTAAAGAGGAGCTGATGTATCACTGGACGTCTCTTCAAGAGTTATTGAGAC
ATTACTGGTCATCATATCCAATCACTACTATGTATCTTTATAATAAGGTAAGCAGGTTGAAGGATGCAATGTCAAAAATTGATTCTCAGCTACAGGAGCT
GAAGGAATCTGTGCAGTCAGATCTTCGACATCAGGTTACTCTATTAATTCGACCAATGCAACAGGCTCTAGAGGTAGCTATGCAACATTATGATGCAGAC
ATGCAGAAGAGATCATCGTGA
AA sequence
>Potri.005G061366.1 pacid=42802349 polypeptide=Potri.005G061366.1.p locus=Potri.005G061366 ID=Potri.005G061366.1.v4.1 annot-version=v4.1
MMEIDDLQASIDLPLAPLSIKDPRDYFDSQQASALKTSRDTSIGNDPVRCTLSVEESYASLRDSISHIKNTGLVDPMVTPEVAAKVLLVLTHNISSTKYD
LGKNPGLSVLDTLPNSIKEELMYHWTSLQELLRHYWSSYPITTMYLYNKVSRLKDAMSKIDSQLQELKESVQSDLRHQVTLLIRPMQQALEVAMQHYDAD
MQKRSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61420 BSD domain (BTF2-like transcri... Potri.005G061366 0 1
AT1G30760 FAD-binding Berberine family p... Potri.011G161400 3.16 0.9029
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Potri.001G255900 7.61 0.9084
AT4G17070 peptidyl-prolyl cis-trans isom... Potri.002G139600 7.74 0.8751
AT4G05320 UBQ10 polyubiquitin 10 (.1.2.3.4.5.6... Potri.001G263000 7.74 0.9109 Pt-UBQ11.1
AT3G13410 unknown protein Potri.003G223601 9.89 0.8864
AT3G53810 Concanavalin A-like lectin pro... Potri.009G035400 14.38 0.8446
AT4G02260 AT-RSH1, RSH1, ... RELA-SPOT HOMOLOG 1, RELA/SPOT... Potri.001G435200 14.42 0.7689
Potri.001G255904 14.89 0.9081
AT4G10590 UBP10 ubiquitin-specific protease 10... Potri.016G067400 14.96 0.8963
AT3G50860 Clathrin adaptor complex small... Potri.005G122900 15.42 0.8720

Potri.005G061366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.