Potri.005G061700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64650 257 / 3e-89 Ribosomal protein L17 family protein (.1)
AT5G09770 256 / 8e-89 Ribosomal protein L17 family protein (.1)
AT3G54210 112 / 3e-31 Ribosomal protein L17 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G107100 286 / 8e-101 AT5G64650 258 / 1e-89 Ribosomal protein L17 family protein (.1)
Potri.006G113500 112 / 2e-31 AT3G54210 253 / 1e-85 Ribosomal protein L17 family protein (.1)
Potri.016G143100 112 / 4e-31 AT3G54210 258 / 7e-88 Ribosomal protein L17 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037314 253 / 2e-87 AT5G09770 274 / 6e-96 Ribosomal protein L17 family protein (.1)
Lus10035729 249 / 7e-86 AT5G09770 271 / 6e-95 Ribosomal protein L17 family protein (.1)
Lus10007002 112 / 1e-31 AT3G54210 244 / 2e-82 Ribosomal protein L17 family protein (.1)
Lus10000382 113 / 2e-31 AT3G54210 245 / 3e-82 Ribosomal protein L17 family protein (.1)
Lus10006999 112 / 1e-30 AT3G54210 248 / 1e-82 Ribosomal protein L17 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01196 Ribosomal_L17 Ribosomal protein L17
Representative CDS sequence
>Potri.005G061700.1 pacid=42803565 polypeptide=Potri.005G061700.1.p locus=Potri.005G061700 ID=Potri.005G061700.1.v4.1 annot-version=v4.1
ATGACGAAATTCAGAAAGCTAAATCGACCCACTGGTCATCGTATGTCCATGCTCAGAACTTTGGTGTCCCAGTTGATCAAACATGAGAGAATTGAAACCA
CTGTTGCAAAGGCAAAAGAGATTCGACGTCTTGCAGATAATATGGTACAGCTTGGGAAAGAGGGGTCCCTTTGTGCTGCAAGGCGTGCTGCGGCATTTGT
GAGAGGGGATGATGTCATTCACAAGCTGTTTTCTGAAATGGCTTACCGTTACAAGGACAGAGCAGGTGGTTACACAAGGATGCTTCGAACTCGCATAAGA
GTTGGTGATGCTGCACCAATGGCCTACATTGAGTTTATTGACAGAGAAAATGAGCTTAGACAGTCCAAACCACCAACCCCTCAACCACCACAGAGAGCTC
CTTTGGATCCCTGGACAAGATCACGGCTTACCAGGCAGTTTGCACCCCCTAAAGAAGAAAAAAGCTCTGATCCTGAGATATGA
AA sequence
>Potri.005G061700.1 pacid=42803565 polypeptide=Potri.005G061700.1.p locus=Potri.005G061700 ID=Potri.005G061700.1.v4.1 annot-version=v4.1
MTKFRKLNRPTGHRMSMLRTLVSQLIKHERIETTVAKAKEIRRLADNMVQLGKEGSLCAARRAAAFVRGDDVIHKLFSEMAYRYKDRAGGYTRMLRTRIR
VGDAAPMAYIEFIDRENELRQSKPPTPQPPQRAPLDPWTRSRLTRQFAPPKEEKSSDPEI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64650 Ribosomal protein L17 family p... Potri.005G061700 0 1
AT4G11060 MTSSB mitochondrially targeted singl... Potri.013G011800 2.23 0.8367
AT2G15000 unknown protein Potri.009G093400 6.78 0.8203
AT3G13160 Tetratricopeptide repeat (TPR)... Potri.004G029900 10.19 0.8066
AT5G55140 ribosomal protein L30 family p... Potri.014G157400 10.39 0.8072
AT5G06360 Ribosomal protein S8e family p... Potri.006G203400 11.95 0.7715
AT1G15870 Mitochondrial glycoprotein fam... Potri.001G047600 12.72 0.7919
AT3G59280 TXR1 THAXTOMIN A RESISTANT 1, Prote... Potri.012G108600 13.26 0.7586
AT1G76940 RNA-binding (RRM/RBD/RNP motif... Potri.002G070200 13.56 0.7186 RBP1.2
AT3G09890 Ankyrin repeat family protein ... Potri.006G121500 13.85 0.7868
AT3G57000 nucleolar essential protein-re... Potri.006G040600 14.96 0.7653

Potri.005G061700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.